KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2260Help
Entry
XOO2260           CDS       T00235                                 

Gene name
hisA
Definition
(GenBank) phosphoribosylformimino-5-aminoimidazole carboxam
  KO
K01814  
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    XOO2260 (hisA)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     XOO2260 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2374633..2375367
Genome map
AA seq 244 aa AA seqDB search
MSFTVYPALDIRNGRVVRLLQGDYARETHYGNDVLPRAQAFADAGAQWMHLVDLDAAKAG
GYTLATTLGEIARATGLQVQTGGGVRSRDDVASILDAGAARVVIGSLAVRDSEMVIAWLQ
EFGADRLTIALDTRQDTDGIWQLPVHGWTETADATLDQLAVRYAQAGLKHLLCTDIARDG
MLSGPNAALYAHLRSLTPQLQVQVSGGARNLADVAAAKAAGCAGIVLGKALLEGHLDLDE
ALAC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccgtttacccggcgctggatattcgcaatggccgcgtggtgcgcttgctg
cagggcgattacgcacgcgaaacgcactacggcaacgacgtgctgccgcgtgcacaggca
ttcgccgacgccggcgcgcaatggatgcatctggtcgatctggatgcggcgaaggcgggc
ggctacacactggccaccacacttggcgaaatcgcgcgtgccaccggcttgcaggtgcag
accggcggcggcgtgcgttcgcgcgacgatgtggcgagcatcctggatgccggtgccgcg
cgcgtggtgatcggctcgttggcggtacgcgacagcgagatggtgatcgcttggctgcag
gaattcggtgccgatcgcctgaccattgcattggatacacgccaggataccgacggcatc
tggcagttgccggtgcacggctggaccgaaacggcagacgccacgctggaccagttggcc
gtgcgttacgcgcaggccggtctgaaacatctgctctgcaccgacatcgcccgcgacggc
atgctgtccggccccaacgcggcgctgtacgcgcacttgcgttcgctcacgccgcagctg
caggtgcaggtctccggcggcgcgcgcaatctggccgacgtcgccgctgccaaggccgca
ggttgcgccggcatcgtgcttggcaaggccttgctggaagggcatctggatctcgacgag
gcactggcatgctga

DBGET integrated database retrieval system