KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2292Help
Entry
XOO2292           CDS       T00235                                 

Gene name
uvrC
Definition
excinuclease ABC subunit C
Orthology
K03703  
excinuclease ABC subunit C
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Nucleotide excision repair
Class
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:xoo03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2426793..2428649)
Genome map
AA seq 618 aa AA seqDB search
MSAGPQSDFDGKAFAAQLSTAPGVYRMYAGDDTLLYVGKAGALRKRVGSYFNGTPKNARL
TSMLSQVARMDVTVTRSEAEALLLENQLIKSLSPRYNVSLRDDKSYPYVLLTREHWPRIA
LHRGPRAVQGRYFGPYTGVTGVRETLSLMHKLFKLRSCEDSVFRNRSRPCLQYQIGRCSG
PCVDLVAAPDYAESVRRATMFLEGKSDQLGEEIMQSMQQASEALEFERAARLRDLLSSLR
SMQNRQYVDGRAADLDVLACATQSSQACVLLLSFRDGRNLGTRSFFPKTNGEDSADEILG
AFVSQYYAEHSPPREILLDREIPETELIEAALSTAAEHKVALKWNVRGERAGYLLLATRN
AQLTLVTELTSQSAQHARSEALREMLGLAEPVKRVECFDISHTMGEATVASCVVFDASGP
VRGQYRRFNISGITPGDDYAAMRQAIERRFRRAVEENGVLPDVLLIDGGAGQLAQAQAAL
ADLGVENVWLVGVAKGEERRAGHEALIMADGRELRPGAASPALQFIQQVRDEAHRFAITG
HRGRRQKARMTSKLEDIPGIGPRRRASLLKHFGGLVGLKAAGEAEIARVEGVNAALAARI
YANLHGLALPDAAGESSP
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagggccccaaagcgatttcgacggaaaagcgtttgctgcgcaactgagcacc
gcgcctggcgtctaccgcatgtatgcgggcgacgacaccttgttgtacgtcggcaaggcg
ggcgcgctgcgtaagcgcgttggcagctatttcaacggcacgccaaaaaatgcccgattg
acctcgatgttgtcgcaggttgcgcgcatggatgtgaccgtcacccgcagcgaagccgaa
gcgctgctgctggaaaaccagctcatcaagtcgctgtcgccgcgctacaacgtctcgctg
cgcgacgacaagagttatccgtacgtgttgttgacgcgcgaacactggccacgcatcgcc
ttgcaccggggtccgcgtgccgtgcaggggcgttatttcggtccttacaccggcgtgacc
ggcgtgcgcgaaacgctcagcctgatgcacaagttgttcaagctgcgcagctgcgaagac
agcgtgttccgcaaccgctcgcggccctgcctgcaatatcagattggacgttgtagtggg
ccgtgcgtggacctggtggcggcgcccgattacgccgagtcggtgcgtcgcgccaccatg
tttctcgaaggcaagagcgatcagctcggcgaagagatcatgcagtcgatgcagcaggcc
agcgaggcgctggagttcgagcgcgccgcacgcttacgcgatctgctgtcgtcgttgcgc
agcatgcagaaccgccaatacgtcgacggccgcgcagccgatctggatgtgctggcctgc
gctacgcaatccagtcaggcctgcgtactgctgctgagttttcgcgatggccgcaatctc
ggcacgcgctcgttctttcccaagaccaatggtgaagacagcgcagacgaaatcctcggt
gcgttcgtgtcgcagtactacgccgagcattcgccgccgcgcgagatcctgctcgaccgc
gaaatcccggagacggagctaatcgaggccgccctcagtaccgcggccgaacacaaggtg
gcgctcaagtggaacgtgcgcggcgagcgtgccggttatctgctgctggccacgcgtaac
gcccagctgaccctggttaccgagctcaccagccagagcgcgcagcacgcacgcagcgag
gccttgcgcgagatgctcgggctggccgagccggtcaaacgcgtggagtgcttcgacatc
agccacacgatgggcgaggcaaccgtcgcctcttgcgtggtgttcgatgccagcggcccg
gtgcgtggccagtatcgacgcttcaatatttccggcatcaccccgggcgacgattacgca
gccatgcggcaggcaatcgagcgtcgcttccgtcgcgcggtggaagagaacggcgtgctg
cccgacgtgctgctgatcgatggcggcgccggtcagctggcgcaggcacaggctgcgctg
gccgacctgggggtcgagaacgtgtggctggtcggcgtggccaagggcgaagagcgccgg
gcagggcacgaagcattgatcatggccgacggccgcgagttgcggccaggcgccgcgtcg
ccggcactgcaattcatccagcaggtgcgtgacgaagcgcaccgctttgccatcaccggc
caccgtgggcgtcgccagaaggcgcgcatgaccagcaagctcgaggatattcccggcatc
ggcccgcggcgtcgcgcaagtctgctcaagcattttggtgggctggtcgggctcaaagcg
gccggcgaggccgagattgcgcgggtggagggggtcaatgccgcacttgccgcgcgaatc
tacgctaacctgcacgggctggcgcttcccgatgcggcaggcgagtcgagtccgtaa

DBGET integrated database retrieval system