KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2334Help
Entry
XOO2334           CDS       T00235                                 

Definition
phospholipase
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    XOO2334
   00565 Ether lipid metabolism
    XOO2334
   00590 Arachidonic acid metabolism
    XOO2334
   00591 Linoleic acid metabolism
    XOO2334
   00592 alpha-Linolenic acid metabolism
    XOO2334
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     XOO2334
    3.1.1.32  phospholipase A1
     XOO2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2471584..2472801
Genome map
AA seq 405 aa AA seqDB search
MYTLRMQTRPLSCVSLCLPGALTSARLLMSKHRTRPLTLIALAAAPLAHAQEIAPQPASP
QACTSVTSDAVRLACYDKALGYTPQLTAEADAAAQLAKQKEAKHDDTRAISRGGDFFRAD
GQDQPKEEAVANAGRGSLLDRRWELAKDSKLGTFQVRGYKPVYLLPAFWTSDTNRTPQSP
NPADSVDTPQPLDNTELKFQLSFKTKVVEDLFGDNGDIWMGYTQSSRWQAYNADASRPFR
ETNYEPEAMLVFRNNYSIFGWKGRMSGISLNHMSNGRADPLSRSWNRVILNFGLDRENWA
LTLRPWFRIKEDRADDNNPDIEDYMGRGDATLVYNKDGQEFAVIARHSLRGGERSHGSVQ
LDYGFPITSLLRGHMQVFDGYGESMIDYNHEATYIGLGVSLLEWF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgtacacactgcgcatgcagacgcgaccgttaagctgcgtttccctgtgcctgcctggc
gcgcttacctcggccagactgctcatgtccaagcaccgcacccgccctctgacgttgatc
gccctggccgctgcgccattggcgcatgcgcaggaaatcgccccgcagccggcctcgccg
caagcctgcacctcggtcacgtccgatgccgtgcgtctggcctgttacgacaaggcgctg
ggctacaccccgcagctcaccgcggaggcggatgccgcagcgcaattggccaagcagaag
gaagccaagcacgacgatacgcgcgcgatcagccggggcggcgatttcttccgcgccgac
ggacaggaccaacccaaagaagaagcggtagcaaacgcgggccgcggctcgttgctggac
cgacgctgggaattggccaaggactccaagttaggcactttccaggtgcgtggctacaag
ccggtgtacctgttgccggcgttctggaccagcgacaccaaccgcaccccgcagtcgccc
aatccggccgactcggtcgacacgccgcagccactggacaacaccgagctgaagttccag
ctcagcttcaagaccaaggtcgtcgaagacctgttcggcgacaatggcgatatctggatg
ggctacacccagagctcgcgctggcaggcctacaacgccgatgcgtcgcgcccgttccgc
gagaccaattacgagcccgaggcgatgctggtgtttcgcaacaactacagcatcttcggc
tggaagggccgcatgagcggcatcagcctcaatcacatgtccaatgggcgtgccgacccg
ctgtcgcgctcctggaaccgggtcatcctgaacttcggcctggatcgcgagaactgggcc
ctgacactgcgcccgtggttccgcattaaggaagaccgcgccgacgacaataatcccgat
atcgaggattacatgggccgcggcgatgcgacgctggtgtacaacaaggatggtcaggaa
ttcgcggtgatcgcacgccattcgctccgtggcggcgaacgctcgcacggctcggtgcag
ctggattacggcttcccgatcaccagcctgttgcgcggccacatgcaagtgttcgacggt
tacggcgaaagcatgatcgactacaaccacgaggcgacttacatcggcctgggcgtgtcg
ttgctggagtggttctaa

DBGET integrated database retrieval system