KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2334Help
Entry
XOO2334           CDS       T00235                                 

Definition
phospholipase
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:xoo00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:xoo00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xoo00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:xoo00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:xoo00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2471584..2472801
Genome map
AA seq 405 aa AA seqDB search
MYTLRMQTRPLSCVSLCLPGALTSARLLMSKHRTRPLTLIALAAAPLAHAQEIAPQPASP
QACTSVTSDAVRLACYDKALGYTPQLTAEADAAAQLAKQKEAKHDDTRAISRGGDFFRAD
GQDQPKEEAVANAGRGSLLDRRWELAKDSKLGTFQVRGYKPVYLLPAFWTSDTNRTPQSP
NPADSVDTPQPLDNTELKFQLSFKTKVVEDLFGDNGDIWMGYTQSSRWQAYNADASRPFR
ETNYEPEAMLVFRNNYSIFGWKGRMSGISLNHMSNGRADPLSRSWNRVILNFGLDRENWA
LTLRPWFRIKEDRADDNNPDIEDYMGRGDATLVYNKDGQEFAVIARHSLRGGERSHGSVQ
LDYGFPITSLLRGHMQVFDGYGESMIDYNHEATYIGLGVSLLEWF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgtacacactgcgcatgcagacgcgaccgttaagctgcgtttccctgtgcctgcctggc
gcgcttacctcggccagactgctcatgtccaagcaccgcacccgccctctgacgttgatc
gccctggccgctgcgccattggcgcatgcgcaggaaatcgccccgcagccggcctcgccg
caagcctgcacctcggtcacgtccgatgccgtgcgtctggcctgttacgacaaggcgctg
ggctacaccccgcagctcaccgcggaggcggatgccgcagcgcaattggccaagcagaag
gaagccaagcacgacgatacgcgcgcgatcagccggggcggcgatttcttccgcgccgac
ggacaggaccaacccaaagaagaagcggtagcaaacgcgggccgcggctcgttgctggac
cgacgctgggaattggccaaggactccaagttaggcactttccaggtgcgtggctacaag
ccggtgtacctgttgccggcgttctggaccagcgacaccaaccgcaccccgcagtcgccc
aatccggccgactcggtcgacacgccgcagccactggacaacaccgagctgaagttccag
ctcagcttcaagaccaaggtcgtcgaagacctgttcggcgacaatggcgatatctggatg
ggctacacccagagctcgcgctggcaggcctacaacgccgatgcgtcgcgcccgttccgc
gagaccaattacgagcccgaggcgatgctggtgtttcgcaacaactacagcatcttcggc
tggaagggccgcatgagcggcatcagcctcaatcacatgtccaatgggcgtgccgacccg
ctgtcgcgctcctggaaccgggtcatcctgaacttcggcctggatcgcgagaactgggcc
ctgacactgcgcccgtggttccgcattaaggaagaccgcgccgacgacaataatcccgat
atcgaggattacatgggccgcggcgatgcgacgctggtgtacaacaaggatggtcaggaa
ttcgcggtgatcgcacgccattcgctccgtggcggcgaacgctcgcacggctcggtgcag
ctggattacggcttcccgatcaccagcctgttgcgcggccacatgcaagtgttcgacggt
tacggcgaaagcatgatcgactacaaccacgaggcgacttacatcggcctgggcgtgtcg
ttgctggagtggttctaa

DBGET integrated database retrieval system