KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2339Help
Entry
XOO2339           CDS       T00235                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase-like protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00480  Glutathione metabolism
xoo00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XOO2339 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XOO2339 (gpo)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XOO2339 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AAW75593
UniProt: Q5H0C8
Position
complement(2478851..2479336)
Genome map
AA seq 161 aa AA seqDB search
MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctctccacctttgaattcaccgaccttgagggtcgcacgcagacgatgcgc
gactacgccggcaaggtgctgctggtggtgaatgtggcatccaaatgcggctttacgccg
cagtacgccggcttgcaggccttatggcaacgctatcgcgagcgcgggctggtagtcatc
ggatttccgtgcgatcagtttgggcatcaagagccaggtgatgcggcgcagatccgccaa
ttttgctcgctcgactacgcagtggattttccgctggccgaaaaaatcgaggtcaacggc
agcggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcggctcc
gaggcgatcaagtggaatttcaccaaattcctgatcggccgcgacggccgcgtgctggaa
cgttatgcgcccacgaccaagccggaagcattggccgcagatatcgagcgtgcattggac
gcatga

DBGET integrated database retrieval system