KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2666Help
Entry
XOO2666           CDS       T00235                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO2666 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XOO2666 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    XOO2666 (proB)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     XOO2666 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2828764..2829918)
Genome map
AA seq 384 aa AA seqDB search
MSTPASTSSPFAEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREL
VIVSSGAVAAGRAILPKAVDVGAPIAARQALAALGQAQLIALWQRFFERPVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDDVPELTPEVLAMAGGSGSNVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSGEVVRALAQDRLRGTRIHAARTRIAARKYWLRHAPVEAGAILVDAGAAM
ALSDKGASLLPGGVVGAEGDFRRGDMVEIRLRDDEGERCLARGVSQYSAVDIRRIARRHS
REIENVLGYSYGENVVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccagccagcacgtcgtcgccctttgccgagcaggcactgccgccgtggcgg
cgtgccgtgctcaaggtcggcagtagcctgcttgctgccgatggcggtggcctgtcgccg
cgtttcgcattggggctggcgcagttcgtctctgctaacctggcggcggggcgcgagctg
gtgatcgtgtcgtcgggcgcagtggcggcgggccgcgccatcctgccgaaagcggtggat
gtcggcgcgccgatcgcggcacgtcaagcgctggctgcgctcggccaggcgcagttgatc
gcgctgtggcagcgctttttcgagcgcccggtggcgcaggtgctgctcacccatgacgat
ctgcgcaaccgtcgccgctatctcaatgcacgcgccacattgggcgagttgttgcggttg
ggcgcgttgccggtgatcaacgaaaacgacaccgtttcggtggatgagttgaagctgggc
gataacgacaacctggccgcaatcgtggccgccttggtcgatgccgatgccttgttcatc
gccactgatatcgacggcttgtatagcgccgacccacgcagtaaccccttggcgcggccg
ctcgacgatgtgcccgagctcacgccggaggtgctggcgatggctggcggcagcggcagc
aatgtaggcaccggcggcatgcgcaccaaattggaagccgctgcaaaggcgggtgcggcc
ggcatcgaaacctatctgttcaacggccgcagtggcgaggtggtgcgcgccctggcgcag
gaccgcctgcgtggcacgcgcatccatgccgcacgcacgcgcattgccgcacgcaagtac
tggctacggcacgcgccggtggaagcgggcgcgattctggtcgatgccggcgcagcaatg
gcgctgagcgacaagggcgcctcgctgttgccgggcggtgtggtcggtgccgagggcgat
ttccgccgcggcgacatggtggagattcgcctgcgtgatgacgagggcgaacgttgtctg
gcacgcggcgtcagccagtattcggcagtggatatccgtcgcatcgcacgccgccactcg
cgcgaaatcgagaacgtactcggttacagctatggcgagaacgtggtgcatcgcgatgat
ttggtgttgttgtag

DBGET integrated database retrieval system