KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2696Help
Entry
XOO2696           CDS       T00235                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xoo00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xoo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2855814..2857037
Genome map
AA seq 407 aa AA seqDB search
MTCPTRPFLRERHHMSESHIRTTCLATALLSLVSANAMALTGTATRPQLTTSEASTYTIT
KALAKAGPITALVTDNWNPTAGVALLSADYAVAADGSTPYRTVQAAIDAAVAAGGTTRRY
ISIKAGTYTGLVCVPTNAPPLTVFGLGTDSTDTVIRFNNANPTPKPTGIASHPCASNAAA
TTVGTSNSATLTVRAAGFQARHLRVDNDYVEGTYTDNNQSAVALAVRGDKASFEDVVITG
NQDTLLISATNAANVIRSYFKNSTIEGDVDFIFGSGVGVFDNALIRSAGARLGSSSGGYI
FAPSTRPGSPYGFLAINSRFVAGSGSPDNQTYLGRAWDEGVRGLSAYVNGTSPNGQVTVR
DSNLGSHIRKTAPWDASTASRPYCSSNCTNSANRFYEYGNSGAGAGN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttgacctgccccacacgtcccttcctgagagagcgccaccacatgtctgaatcgcacatc
cgtacgacctgcctcgccaccgcactgttgagccttgtcagcgccaatgcgatggcattg
accggcaccgccacgcgaccgcaactcaccactagcgaagcaagcacctacaccatcaca
aaagccttggccaaggccggaccgatcactgcgctggtgaccgacaattggaatcccacg
gcaggcgttgccttgctcagcgccgattacgcagtggctgccgacggctcgacaccctac
cgcaccgtgcaggcggctattgatgcggcggttgctgcaggcggcaccacacgtcgctac
atcagcatcaaggcgggcacctacaccggactggtgtgcgtgcccaccaatgcgccacca
ctgacggtgttcgggctgggcaccgacagcacagatacggtcatccgcttcaacaatgcc
aaccccactcccaaaccgactggcatcgcaagccacccttgcgcaagcaatgcagcggca
accacggtgggcacgtccaatagcgctacgttgacggtgcgcgcagcaggcttccaggcg
cgtcacctgcgcgtggacaacgactatgtcgaaggcacttacacagacaataaccagtcg
gctgtcgcgctggcagtgcgtggtgacaaagccagtttcgaagacgtcgtgatcaccggt
aaccaggacaccttgttgatcagcgcgaccaacgcggccaatgtgatccgctcttacttc
aagaacagcacaatcgagggcgacgtcgatttcatcttcggctcgggtgtcggcgtgttc
gacaatgccctcatccgctccgctggcgcgcgcctgggcagcagcagcggcggctacatc
ttcgcgcccagtacgcgcccgggcagtccctatggttttctcgcgatcaatagccgcttt
gtggctggctcaggctcgcccgacaaccagacctaccttgggcgtgcctgggacgaaggc
gtccgcggcctgtcggcctacgtcaacggcacctcgcccaatgggcaagtgacagtgcgc
gattccaacctgggcagccatattcgcaagaccgcgccgtgggatgcgtccaccgccagc
cgcccgtattgcagcagcaattgcaccaattcggcgaaccgcttttatgagtatgggaac
agcggcgccggcgctgggaattag

DBGET integrated database retrieval system