KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2955Help
Entry
XOO2955           CDS       T00235                                 

Gene name
pcm
Definition
L-isoaspartate protein carboxylmethyltransferase type II
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
Enzymes [BR:xoo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XOO2955 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3163944..3164621)
Genome map
AA seq 225 aa AA seqDB search
MTPRLRLQPESVGIGMTSQRVRDRLVERLREAGIHDEATLNAMQTVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVTPTKVLEVGTGSGYQGAILAALGLEVYTVE
RIGDLLRQARKRFRHLGMNVRSKHDDGRIGWHEHGPYDAIVVTAAAPALVDALVDQLAVG
GRLVAPVGGASSQSLVQLTRGADGTIEQQVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaggctgcgcctgcaaccggagtcggtcggaatcggcatgacctcgcagcgc
gtgcgcgaccgcctggtcgaacggctgcgcgaggctggcatccacgacgaggcgacgctc
aacgcgatgcagaccgtgccgcggcacttgttcatcgatgaagcgctggcctcgcgcgcg
tacgaagacaccgcgctgccgatcggccacggccagaccatctcgcagccatgggtggtg
gcgcgcatgaccgaggcagtgctgcaagtgacgccgaccaaggtgctcgaagtgggcacc
ggctccggctaccagggcgcgattctggcggcgctggggctggaggtgtacaccgtcgag
cgcattggcgatctgttacggcaagcgcgcaagcgctttcggcatctgggcatgaacgtg
cgcagcaagcacgacgacggccgtatcggctggcacgagcacggcccctatgacgccatc
gtggtgaccgccgccgcaccggcgctggtcgatgcgctggtcgatcagctggcggtcggt
ggacgcctggtcgctccggtcggcggcgcttcctcgcaatcgctggtgcaactcacacgc
ggcgccgatggcaccatcgaacaacaggttctggcgccggtcacgttcgtcccgctgttg
tcgggcatgctggattga

DBGET integrated database retrieval system