KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3001Help
Entry
XOO3001           CDS       T00235                                 

Gene name
cycA
Definition
(GenBank) cytochrome C2
  KO
K08738  
cytochrome c
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XOO3001 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOO3001 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3210290..3210682
Genome map
AA seq 130 aa AA seqDB search
MNSPRKLPVLCVPLAGLLLAGALPVPSARAADGAGTFLTECGECHSAKQGKNKKGPSLFG
VAGRPAGTVADFSGYSDALKNSKWTWTPAQLKTYLSHSSTKALPGTKMKYDGLDDPKELD
ALITYLNTLK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaccacgcaagctccccgtgttgtgcgtcccgctggctggtctgttgctggca
ggcgcactgcccgtgccatcggcacgcgctgccgacggtgccggcaccttcctcaccgaa
tgcggcgaatgccatagcgccaaacagggcaaaaacaagaaaggcccgtccctgttcggc
gtggccggccgccctgccggcaccgtggctgatttcagcggttactccgacgcgctcaag
aacagcaagtggacctggaccccggcccagctcaagacctacttgtcgcactcctcgacc
aaggccctgccaggtaccaagatgaagtacgacggcctggacgatccgaaggagctcgac
gcgttgatcacctacctcaacaccttgaagtag

DBGET integrated database retrieval system