KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3001Help
Entry
XOO3001           CDS       T00235                                 

Gene name
cycA
Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xoo00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xoo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3210317..3210682
Genome map
AA seq 121 aa AA seqDB search
MCVPLAGLLLAGALPVPSARAADGAGTFLTECGECHSAKQGKNKKGPSLFGVAGRPAGTV
ADFSGYSDALKNSKWTWTPAQLKTYLSHSSTKALPGTKMKYDGLDDPKELDALITYLNTL
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgtcccgctggctggtctgttgctggcaggcgcactgcccgtgccatcggcacgc
gctgccgacggtgccggcaccttcctcaccgaatgcggcgaatgccatagcgccaaacag
ggcaaaaacaagaaaggcccgtccctgttcggcgtggccggccgccctgccggcaccgtg
gctgatttcagcggttactccgacgcgctcaagaacagcaagtggacctggaccccggcc
cagctcaagacctacttgtcgcactcctcgaccaaggccctgccaggtaccaagatgaag
tacgacggcctggacgatccgaaggagctcgacgcgttgatcacctacctcaacaccttg
aagtag

DBGET integrated database retrieval system