KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3238Help
Entry
XOO3238           CDS       T00235                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00010  Glycolysis / Gluconeogenesis
xoo00051  Fructose and mannose metabolism
xoo00562  Inositol phosphate metabolism
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
xoo01200  Carbon metabolism
xoo01230  Biosynthesis of amino acids
Module
xoo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO3238 (tpiA)
   00051 Fructose and mannose metabolism
    XOO3238 (tpiA)
   00562 Inositol phosphate metabolism
    XOO3238 (tpiA)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XOO3238 (tpiA)
Exosome [BR:xoo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XOO3238 (tpiA)
  Exosomal proteins of bladder cancer cells
   XOO3238 (tpiA)
  Exosomal proteins of melanoma cells
   XOO3238 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAW76492
UniProt: Q5GXS9
Position
complement(3477005..3477805)
Genome map
AA seq 266 aa AA seqDB search
MGYSVACLQLRNLRLMRRKIVAGNWKLHGSRAFATELVAKLAAHMPLEGIDVVILPPLPY
LGDLIEDFEAHHLSFGAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHQESS
ELVARKFAAAIHAGLTPVLCVGESLEQREAGQTEAILRAQLEPVLALVGSAGFAGAVLAY
EPIWAIGTGCTATPEQAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPD
VDGGLVGGASLVAEDFLAIARAAAAC
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggctattctgtcgcctgtcttcaactcaggaacctgcgcctgatgcgtcgaaagatc
gttgccggaaattggaagctgcatggcagccgcgccttcgccaccgaactggtggccaag
ctcgccgcgcacatgcccctggagggtatcgacgtcgtcatcctgccgccactgccttac
ctcggcgacctgatcgaggatttcgaggcccatcacctgtcgttcggagcccaggacgtc
agcagcaatgagaagggcgcctacactggcgaggtctcggcctcgatgttggtggatgtc
ggtgccggctacgggctggtcggccactccgagcgccgtcagtaccatcaggagagtagc
gagctggtggcgcgcaagttcgccgccgcgatccatgccgggctgactccggtgctgtgc
gtgggcgaatcgctggaacagcgtgaagccggtcagactgaggcaatcctacgtgcccag
ctcgaaccggtcctggcgctggtcggcagtgccggtttcgcgggcgccgtgctggcctat
gaaccgatctgggccattggcaccggctgtaccgccacgccggagcaggcccaggccgtg
cacgccttcctgcgtggcgaagtcgcgaaggcggatgctagaatcgctgattcgttgccc
atcctgtacgggggcagtgtcaagcccgataacgccggcgagctgtttgcacagcccgat
gtcgatggcgggctggtcggaggcgcttcactggtcgccgaagatttcctggccatcgca
cgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system