KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3238Help
Entry
XOO3238           CDS       T00235                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XOO3238 (tpiA)
   01230 Biosynthesis of amino acids
    XOO3238 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO3238 (tpiA)
   00051 Fructose and mannose metabolism
    XOO3238 (tpiA)
   00562 Inositol phosphate metabolism
    XOO3238 (tpiA)
Enzymes [BR:xoo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XOO3238 (tpiA)
Exosome [BR:xoo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XOO3238 (tpiA)
  Exosomal proteins of bladder cancer cells
   XOO3238 (tpiA)
  Exosomal proteins of melanoma cells
   XOO3238 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3477005..3477805)
Genome map
AA seq 266 aa AA seqDB search
MGYSVACLQLRNLRLMRRKIVAGNWKLHGSRAFATELVAKLAAHMPLEGIDVVILPPLPY
LGDLIEDFEAHHLSFGAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHQESS
ELVARKFAAAIHAGLTPVLCVGESLEQREAGQTEAILRAQLEPVLALVGSAGFAGAVLAY
EPIWAIGTGCTATPEQAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPD
VDGGLVGGASLVAEDFLAIARAAAAC
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggctattctgtcgcctgtcttcaactcaggaacctgcgcctgatgcgtcgaaagatc
gttgccggaaattggaagctgcatggcagccgcgccttcgccaccgaactggtggccaag
ctcgccgcgcacatgcccctggagggtatcgacgtcgtcatcctgccgccactgccttac
ctcggcgacctgatcgaggatttcgaggcccatcacctgtcgttcggagcccaggacgtc
agcagcaatgagaagggcgcctacactggcgaggtctcggcctcgatgttggtggatgtc
ggtgccggctacgggctggtcggccactccgagcgccgtcagtaccatcaggagagtagc
gagctggtggcgcgcaagttcgccgccgcgatccatgccgggctgactccggtgctgtgc
gtgggcgaatcgctggaacagcgtgaagccggtcagactgaggcaatcctacgtgcccag
ctcgaaccggtcctggcgctggtcggcagtgccggtttcgcgggcgccgtgctggcctat
gaaccgatctgggccattggcaccggctgtaccgccacgccggagcaggcccaggccgtg
cacgccttcctgcgtggcgaagtcgcgaaggcggatgctagaatcgctgattcgttgccc
atcctgtacgggggcagtgtcaagcccgataacgccggcgagctgtttgcacagcccgat
gtcgatggcgggctggtcggaggcgcttcactggtcgccgaagatttcctggccatcgca
cgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system