KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3251Help
Entry
XOO3251           CDS       T00235                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO3251 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOO3251 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOO3251 (trpA)
Enzymes [BR:xoo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XOO3251 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3488262..3489128)
Genome map
AA seq 288 aa AA seqDB search
MPPDVTWRLAFLPPLDSSDFMRRIDFRFAELRANGRKALIPFITAGDPSLEATVPVMHAL
VRAGADVIELGVPFSDPMADGPTIQRSSERALGRGAGLAYVLEAVHEFRREDAATPVVLM
GYLNPIEIHGTRRFAEAAVAAGVDGLLLVDLPPEEADETRAIFTEVGLALIALASPTTSE
QRLDMLCSTAQGYLYYVSFAGVTGASNLLDTHAASDRLRQLRQRAGAPVVAGFGIKDAAS
AAAMAVDADGVVVGSALVAALAEADDVRSARERAEAFLAPLRQALDQA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgccacctgacgtgacatggcggctggctttcctccccccccttgattcgagtgatttc
atgcgtcgtatcgatttccgcttcgccgagctgcgtgccaacggtcgcaaggcactgatc
cccttcatcaccgccggcgacccgtcgctggaagccactgtgcccgtcatgcacgcgctg
gtgcgcgccggcgccgatgtcatcgagctcggtgtgccgttctccgacccgatggcggac
ggccccaccatccagcgcagctccgagcgcgcgctgggacgcggtgccggccttgcgtac
gtgttggaagcggtgcacgagttccgccgcgaagacgccgccacgccggtggtgttgatg
ggctacctcaacccgatcgagatccatggcacgcggcgcttcgccgaagcggctgtcgcc
gccggcgtggacggcctgctgctggtcgatctgccgccggaggaagccgatgaaacgcgc
gccatcttcaccgaggtcgggctggcgctgatcgcactggcatcgcccaccaccagtgag
cagcgcctggacatgctgtgcagcactgcgcagggctatctgtattacgtcagttttgct
ggcgtcaccggcgcctccaacctgctcgacacccacgccgccagcgaccgcctgcgccaa
ctgcgtcagcgtgccggcgcgccggtggtggccggcttcggcatcaaggacgccgccagc
gctgccgccatggcggtggatgcggacggcgtggtggtcggcagtgctctggttgccgcc
ctggccgaagccgacgacgtccgcagcgctcgcgaacgcgcagaggccttcctggccccc
ttgcgccaagccctcgaccaagcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system