KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3329Help
Entry
XOO3329           CDS       T00235                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:xoo00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3561980..3564622)
Genome map
AA seq 880 aa AA seqDB search
MSTVEPNVYDPHQVETSAQQFWDATRAFQVDENSEKPKFYCLSMLPYPSGALHMGHVRNY
TISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAIKNKTAPAKWTYANIAHMRAQLKSLG
YAIDWSREFATCTPDYYVHEQRMFTRLMRKGLAYRRNAVVNWDPIDQTVLANEQVIDGRG
WRSGAVVEKREIPQWFLRITDYAQELLDGLDQLDGWPDSVKTMQRNWIGRSEGLEIQFDV
RDTNGAALDPLRVFTTRPDTLMGVTFVSIAAEHPLALHAAKSNPELAALLETLKHGGVSE
AELETQEKRGMATGLTAVHPISGEQVPVWVANFVLMGYGTGAVMAVPGHDQRDFEFANKY
GLPIVQVVKLREPRNDDEQRWDATEWRDWYTDKSRELELINSAEFDGLDFGGAFEALAER
FERKGQGQRRVNYRLRDWGVSRQRYWGCPIPVIYCPKCGAVPVPEDQLPVVLPENVEFAC
TGSPIKTDPTWRQTTCPDCGGPAERETDTFDTFMESSWYVARYTSPNAREMVDRRANYWM
PADLYVGGIEHAILHLMYFRFYHKLMRDARLVDSDEPVTNLLTQGMVIADTFYRDADNGG
KDWINPADVEIQRDERGRVTGAVLIADGQPVHIGGTEKMSKSKNNGVDPQSMVAKYGADT
VRLFSMFAAPPEQSLEWNEAGVDGMARFMRRLWAQVHKHVGEGAAVALDVAALSAEQKAI
RRKTHETIGKVSDDYGRRHSFNTAIAAVMELSNALAKFDDASDQGRAVRQEALEAMVLLL
NPITPHASHALWQVLGRGETLLENVAFPQADVSALVRDALTLAVQINGKLRGTIDVAADA
AREQIEALAQAEPNAAKFLDGLSVRKIIIVPGKIVNIVAG
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgaaccgaacgtctacgacccgcaccaggtcgaaacctccgcccagcag
ttttgggatgccacccgcgccttccaggtcgacgagaactcggaaaaacccaagttctat
tgcctgtcgatgctgccctacccgtccggtgcgctgcacatgggccatgtgcgcaactac
accatctccgacgtggtcagccgctacaagcgcatgaccggccacaacgtgctgcagccg
atgggctgggatgcgttcggattgccggcggaaaacgccgccatcaagaacaagaccgcg
ccggccaagtggacctacgccaacatcgcgcacatgcgcgcgcagctgaagtcgctgggc
tacgccatcgactggtcgcgcgagttcgccacctgcacgccggactattacgtgcacgag
cagcgcatgttcacccggctgatgcgcaagggtttggcctatcgccgcaatgcggtggtg
aactgggatccgatcgatcagaccgtgctggccaacgagcaggtcatcgacggccgcggc
tggcgctccggcgcggtggtggaaaagcgcgagattccgcaatggttcctgcgcatcacc
gattacgcgcaggaattgctcgacggtctggaccagctggacggctggccggactcggtc
aagaccatgcagcgcaactggatcggccgctccgaaggcctggaaatccagttcgacgtg
cgcgacaccaacggtgccgcactggatccgctgcgcgtgttcaccacccgcccggacacg
ctgatgggcgtgaccttcgtgtcgatcgccgccgagcatccgctggcgttgcatgcggcc
aaatccaatccggaactggccgcgctgctggaaacgctcaagcacggcggcgtctccgag
gccgagctggaaacccaggaaaagcgcggcatggccactggcctgaccgcagtgcatccc
atcagcggcgagcaggtgccggtgtgggtggccaacttcgtgctgatgggctacggcacc
ggcgcggtgatggcggtgcccggccacgaccagcgcgatttcgaattcgccaacaagtac
ggcctgccgatcgtgcaggtggtcaagctacgcgagccgcgcaacgacgacgagcagcgc
tgggacgccaccgagtggcgcgattggtacaccgacaagagccgcgagctggagctgatc
aattcggccgagttcgatggcctggatttcggtggtgccttcgaagccttggctgagcgc
ttcgagcgcaagggccagggccagcgccgggtcaattaccgcctgcgcgactggggcgtg
agccgccagcgctactggggctgccccattccggtgatctactgccccaagtgcggcgcg
gtgccggtgccggaagaccagttgccggtggtgctgccggaaaacgtggaatttgcctgt
accggttcgccgatcaagaccgatccgacctggcgccagaccacctgcccggactgcggc
ggcccggccgagcgcgagaccgacaccttcgacaccttcatggaatcgagctggtacgtg
gcgcgctacaccagcccgaacgcacgcgagatggtcgatcgccgcgccaattactggatg
ccggccgacctgtacgtgggcggcatcgagcacgcgatcctgcacctgatgtacttccgc
ttctatcacaagctcatgcgcgatgcgcggctggtggacagtgacgagccggtgaccaac
ctgctcacccagggcatggtcatcgccgacacgttctatcgcgatgccgacaacggcggc
aaggactggatcaacccggccgacgtggaaatccagcgcgacgagcgcggccgcgtcacc
ggtgcggtgctgatcgccgacggccagccggtgcacatcggcggcaccgagaagatgtcc
aagtccaagaacaacggcgtggacccgcagtcgatggtggccaagtacggcgccgatacg
gtgcggctgttctcgatgttcgccgcaccgccggagcaatcgctggaatggaacgaagcc
ggcgtggacggcatggcgcgcttcatgcgccggctgtgggcgcaggtgcacaagcatgtg
ggcgagggcgctgccgtcgcgctggacgttgccgcgttgagcgccgagcagaaagcgatc
cgccgcaagacccatgaaaccatcggcaaggtcagcgacgactacggccgccgccacagc
ttcaacaccgccattgccgcagtgatggaactgtccaacgcgctggccaagttcgacgac
gccagcgaccagggccgtgcggtgcgccaggaagcgctggaagcgatggtgctgttgctc
aacccgatcaccccgcacgccagtcatgcgttgtggcaagtgctcggtcgtggcgaaacg
ctgctggaaaacgtcgcgtttccgcaggccgatgtcagcgcgctggtgcgcgatgcactg
acgctggcggtgcagatcaacggcaagttgcgcggcaccatcgacgtcgccgccgatgcg
gcccgcgaacagatcgaggcactggcgcaggccgagccgaatgccgccaagttcctcgat
ggcctgagcgtgcgcaagatcatcatcgtgccgggcaagatcgtgaatatcgtcgcggga
taa

DBGET integrated database retrieval system