KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3329Help
Entry
XOO3329           CDS       T00235                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    XOO3329 (leuS)
Enzymes [BR:xoo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     XOO3329 (leuS)
Amino acid related enzymes [BR:xoo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XOO3329 (leuS)
Transfer RNA biogenesis [BR:xoo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XOO3329 (leuS)
 Prokaryotic Type
    XOO3329 (leuS)
Mitochondrial biogenesis [BR:xoo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    XOO3329 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3561980..3564622)
Genome map
AA seq 880 aa AA seqDB search
MSTVEPNVYDPHQVETSAQQFWDATRAFQVDENSEKPKFYCLSMLPYPSGALHMGHVRNY
TISDVVSRYKRMTGHNVLQPMGWDAFGLPAENAAIKNKTAPAKWTYANIAHMRAQLKSLG
YAIDWSREFATCTPDYYVHEQRMFTRLMRKGLAYRRNAVVNWDPIDQTVLANEQVIDGRG
WRSGAVVEKREIPQWFLRITDYAQELLDGLDQLDGWPDSVKTMQRNWIGRSEGLEIQFDV
RDTNGAALDPLRVFTTRPDTLMGVTFVSIAAEHPLALHAAKSNPELAALLETLKHGGVSE
AELETQEKRGMATGLTAVHPISGEQVPVWVANFVLMGYGTGAVMAVPGHDQRDFEFANKY
GLPIVQVVKLREPRNDDEQRWDATEWRDWYTDKSRELELINSAEFDGLDFGGAFEALAER
FERKGQGQRRVNYRLRDWGVSRQRYWGCPIPVIYCPKCGAVPVPEDQLPVVLPENVEFAC
TGSPIKTDPTWRQTTCPDCGGPAERETDTFDTFMESSWYVARYTSPNAREMVDRRANYWM
PADLYVGGIEHAILHLMYFRFYHKLMRDARLVDSDEPVTNLLTQGMVIADTFYRDADNGG
KDWINPADVEIQRDERGRVTGAVLIADGQPVHIGGTEKMSKSKNNGVDPQSMVAKYGADT
VRLFSMFAAPPEQSLEWNEAGVDGMARFMRRLWAQVHKHVGEGAAVALDVAALSAEQKAI
RRKTHETIGKVSDDYGRRHSFNTAIAAVMELSNALAKFDDASDQGRAVRQEALEAMVLLL
NPITPHASHALWQVLGRGETLLENVAFPQADVSALVRDALTLAVQINGKLRGTIDVAADA
AREQIEALAQAEPNAAKFLDGLSVRKIIIVPGKIVNIVAG
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgaaccgaacgtctacgacccgcaccaggtcgaaacctccgcccagcag
ttttgggatgccacccgcgccttccaggtcgacgagaactcggaaaaacccaagttctat
tgcctgtcgatgctgccctacccgtccggtgcgctgcacatgggccatgtgcgcaactac
accatctccgacgtggtcagccgctacaagcgcatgaccggccacaacgtgctgcagccg
atgggctgggatgcgttcggattgccggcggaaaacgccgccatcaagaacaagaccgcg
ccggccaagtggacctacgccaacatcgcgcacatgcgcgcgcagctgaagtcgctgggc
tacgccatcgactggtcgcgcgagttcgccacctgcacgccggactattacgtgcacgag
cagcgcatgttcacccggctgatgcgcaagggtttggcctatcgccgcaatgcggtggtg
aactgggatccgatcgatcagaccgtgctggccaacgagcaggtcatcgacggccgcggc
tggcgctccggcgcggtggtggaaaagcgcgagattccgcaatggttcctgcgcatcacc
gattacgcgcaggaattgctcgacggtctggaccagctggacggctggccggactcggtc
aagaccatgcagcgcaactggatcggccgctccgaaggcctggaaatccagttcgacgtg
cgcgacaccaacggtgccgcactggatccgctgcgcgtgttcaccacccgcccggacacg
ctgatgggcgtgaccttcgtgtcgatcgccgccgagcatccgctggcgttgcatgcggcc
aaatccaatccggaactggccgcgctgctggaaacgctcaagcacggcggcgtctccgag
gccgagctggaaacccaggaaaagcgcggcatggccactggcctgaccgcagtgcatccc
atcagcggcgagcaggtgccggtgtgggtggccaacttcgtgctgatgggctacggcacc
ggcgcggtgatggcggtgcccggccacgaccagcgcgatttcgaattcgccaacaagtac
ggcctgccgatcgtgcaggtggtcaagctacgcgagccgcgcaacgacgacgagcagcgc
tgggacgccaccgagtggcgcgattggtacaccgacaagagccgcgagctggagctgatc
aattcggccgagttcgatggcctggatttcggtggtgccttcgaagccttggctgagcgc
ttcgagcgcaagggccagggccagcgccgggtcaattaccgcctgcgcgactggggcgtg
agccgccagcgctactggggctgccccattccggtgatctactgccccaagtgcggcgcg
gtgccggtgccggaagaccagttgccggtggtgctgccggaaaacgtggaatttgcctgt
accggttcgccgatcaagaccgatccgacctggcgccagaccacctgcccggactgcggc
ggcccggccgagcgcgagaccgacaccttcgacaccttcatggaatcgagctggtacgtg
gcgcgctacaccagcccgaacgcacgcgagatggtcgatcgccgcgccaattactggatg
ccggccgacctgtacgtgggcggcatcgagcacgcgatcctgcacctgatgtacttccgc
ttctatcacaagctcatgcgcgatgcgcggctggtggacagtgacgagccggtgaccaac
ctgctcacccagggcatggtcatcgccgacacgttctatcgcgatgccgacaacggcggc
aaggactggatcaacccggccgacgtggaaatccagcgcgacgagcgcggccgcgtcacc
ggtgcggtgctgatcgccgacggccagccggtgcacatcggcggcaccgagaagatgtcc
aagtccaagaacaacggcgtggacccgcagtcgatggtggccaagtacggcgccgatacg
gtgcggctgttctcgatgttcgccgcaccgccggagcaatcgctggaatggaacgaagcc
ggcgtggacggcatggcgcgcttcatgcgccggctgtgggcgcaggtgcacaagcatgtg
ggcgagggcgctgccgtcgcgctggacgttgccgcgttgagcgccgagcagaaagcgatc
cgccgcaagacccatgaaaccatcggcaaggtcagcgacgactacggccgccgccacagc
ttcaacaccgccattgccgcagtgatggaactgtccaacgcgctggccaagttcgacgac
gccagcgaccagggccgtgcggtgcgccaggaagcgctggaagcgatggtgctgttgctc
aacccgatcaccccgcacgccagtcatgcgttgtggcaagtgctcggtcgtggcgaaacg
ctgctggaaaacgtcgcgtttccgcaggccgatgtcagcgcgctggtgcgcgatgcactg
acgctggcggtgcagatcaacggcaagttgcgcggcaccatcgacgtcgccgccgatgcg
gcccgcgaacagatcgaggcactggcgcaggccgagccgaatgccgccaagttcctcgat
ggcctgagcgtgcgcaagatcatcatcgtgccgggcaagatcgtgaatatcgtcgcggga
taa

DBGET integrated database retrieval system