KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3764Help
Entry
XOO3764           CDS       T00235                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xoo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4015572..4016240)
Genome map
AA seq 222 aa AA seqDB search
MRNLRMRERTLRYGALSLWLLTLSLLAPGIASAKLPVATAPILVVGDSLSAAHNIPVQSG
WVTLLDQRLKRDMATPPPLVNTSISGETTSGALTRLPGLLEKHHPGVVVIELGGNDALRG
LTPTQLKGNLEKMIQLSQQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYKTALVP
FFLEKVVLQPGLMQADGLHPTAAAQPKVLETVWPALRPLLGS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatctccgaatgcgtgaaagaacactgcgatatggcgcgctgtccctgtggctg
ctgacactctccctgcttgcgccggggattgcctctgccaaacttccggtcgccaccgcg
ccgatcctggtcgtcggcgacagtctgagcgctgcgcacaacatcccggtccagtccggc
tgggtgaccttgctggaccagcgcctgaaacgtgacatggcgacgccacccccgctcgtc
aataccagcatcagcggcgagaccacatccggtgcactgactcgcctgccgggcctgctg
gaaaaacaccatcccggcgtcgtggtgatcgaactcggcggcaacgatgcgctgcgcggc
ctgaccccgacccagctcaagggcaacctggaaaagatgatccagctcagccagcaggcc
ggcgccaaggtgctgctgctggggatcgatgtgccgcccaattacggcccagcctaccgc
gagcggctcaaggcgacctacgccgacctctccaaacagtacaaaaccgcgctggtgccg
ttctttctggagaaggtcgtgttgcagccgggcctgatgcaggccgacggtctgcacccc
actgccgccgcccagccgaaggtactggagacggtgtggccagcgttgcgcccgctgctc
gggtcctaa

DBGET integrated database retrieval system