KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3764Help
Entry
XOO3764           CDS       T00235                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XOO3764 (tesA)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     XOO3764 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     XOO3764 (tesA)
Lipid biosynthesis proteins [BR:xoo01004]
 Fatty acid synthase
  Component type
   XOO3764 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4015572..4016240)
Genome map
AA seq 222 aa AA seqDB search
MRNLRMRERTLRYGALSLWLLTLSLLAPGIASAKLPVATAPILVVGDSLSAAHNIPVQSG
WVTLLDQRLKRDMATPPPLVNTSISGETTSGALTRLPGLLEKHHPGVVVIELGGNDALRG
LTPTQLKGNLEKMIQLSQQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYKTALVP
FFLEKVVLQPGLMQADGLHPTAAAQPKVLETVWPALRPLLGS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatctccgaatgcgtgaaagaacactgcgatatggcgcgctgtccctgtggctg
ctgacactctccctgcttgcgccggggattgcctctgccaaacttccggtcgccaccgcg
ccgatcctggtcgtcggcgacagtctgagcgctgcgcacaacatcccggtccagtccggc
tgggtgaccttgctggaccagcgcctgaaacgtgacatggcgacgccacccccgctcgtc
aataccagcatcagcggcgagaccacatccggtgcactgactcgcctgccgggcctgctg
gaaaaacaccatcccggcgtcgtggtgatcgaactcggcggcaacgatgcgctgcgcggc
ctgaccccgacccagctcaagggcaacctggaaaagatgatccagctcagccagcaggcc
ggcgccaaggtgctgctgctggggatcgatgtgccgcccaattacggcccagcctaccgc
gagcggctcaaggcgacctacgccgacctctccaaacagtacaaaaccgcgctggtgccg
ttctttctggagaaggtcgtgttgcagccgggcctgatgcaggccgacggtctgcacccc
actgccgccgcccagccgaaggtactggagacggtgtggccagcgttgcgcccgctgctc
gggtcctaa

DBGET integrated database retrieval system