KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3785Help
Entry
XOO3785           CDS       T00235                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XOO3785 (rbsK)
Enzymes [BR:xoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XOO3785 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4031394..4032464
Genome map
AA seq 356 aa AA seqDB search
MPACCRISVKAARVHRHNGLITARRVSFSHSSQSFKARIFMSSVVVVGSFNVDHVWRCDA
LPLPGATIAGRYSTGPGGKGFNQAVAAARAGAKTHFLCALGDDAGGALARSLAAQDGFAL
IAEPSNEPTGTGGIYVDGHGRNTIVIGAGANAVLSPAFIDNQRPLIAAAKVLLAQLESPA
ETIESALALAHECGVLTVLNAAPANAPTSIGLLKLSDVLTPNETEFAALLGRHVGERINA
DNVAALDGNTLHSLCRKLLPGGSVVVTLGAVGAFISHAEEQLRGDTQAHYRVRAESAQTI
DTTGAGDAFNGALVASLAQLPAAGFATHVRFATRYAARSTEVEGAAVSMPRLRADD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgccggcgtgctgtcgcatttcggttaaggcggcgcgggttcatcggcataacggtcta
atcactgcacgccgcgtttcattcagtcattcaagtcagtcattcaaggcaaggatattt
atgagttcggtcgtcgttgtcgggtccttcaatgtcgatcacgtgtggcgctgcgatgca
ttgccactgccaggtgccaccatcgccgggcgctacagcaccggcccaggcggcaagggc
ttcaatcaggcagttgcggctgcacgtgctggcgccaagacgcattttttgtgcgcgctg
ggcgacgatgccgggggtgcgctggcgcggtcgctggccgcgcaggatggttttgcgctg
atcgccgagccgagcaatgaaccgaccggcactggtggcatctatgtcgacgggcacggc
cgcaataccatcgtgatcggtgccggcgccaacgccgtattgagccctgccttcatcgac
aatcagcgtccgctgattgctgcggcgaaggtgctgctggcgcagttggaatcgccggct
gagacgatcgagtcggcactggcgctggcgcacgaatgcggggtgctgaccgtgctcaat
gccgcaccggcaaatgcgccgacctcaatcggcctgcttaaactgtcggatgtgttgacg
cctaacgaaaccgaattcgccgccctgctcggtcgccatgtcggcgaacgcatcaatgcc
gacaatgtcgctgcgctggatggcaatacgctgcattcgctgtgccgcaagttgttgcct
ggtggcagcgtggtcgtcaccctcggcgcggtgggggccttcatttcgcacgccgaagag
caactgcgcggcgacacccaagcgcattatcgggtgcgtgcggaaagcgcacagaccatc
gacaccaccggtgccggcgatgccttcaacggcgcactggtggcatcgcttgcgcagctg
ccggctgcaggcttcgccacccacgtgcgctttgccacgcgttatgcggcccgctccacc
gaagtggaaggcgcggctgtgtcgatgccgcggctgcgcgcagacgactga

DBGET integrated database retrieval system