KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4088Help
Entry
XOO4088           CDS       T00235                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00860  Porphyrin and chlorophyll metabolism
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XOO4088 (hemD)
Enzymes [BR:xoo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XOO4088 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Tom5
Motif
Other DBs
NCBI-ProteinID: AAW77342
UniProt: Q5GVD1
Position
complement(4372968..4373771)
Genome map
AA seq 267 aa AA seqDB search
MAALSHNHTMTGLAHPDAAWILISLRPSGEHAPLRRAVARHGGRVLALSPWRLQTNDAAQ
ARDALRQALAAPIAVFTSPAAVQAAHRLAPLQRPAQAHWVSVGDGTARALQACGIDTVVR
PTRMDSEGLLALPLLQAPLQAVGLITAPGGRGMLAPTLEQRGARIVRADVYQRIPLRLRA
SAIQALSHALPRSVLALSSAEALTLVLQQLPSALIEKWQQRPVVASSDRMLDAAHAAGFI
HRMRAEGPLPKQLAAAAAAIVTPPRPC
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcgctctcgcataatcacaccatgaccggccttgcccatcccgatgctgcctgg
atcctgatctcgctgcgccccagcggcgaacatgcgccgctacggcgggcggttgcgcgg
catggcgggcgggtactggcgctgtcgccgtggcgcttgcagaccaacgatgccgcacag
gcgcgggacgcgctgcgacaggcgctggcagcaccgattgcggtgttcaccagcccggcg
gccgtgcaggcggcgcatcgtctggcgccgctgcagcgcccggcgcaggcgcactgggtg
agcgtgggcgatggcactgcgcgcgcattgcaggcctgcggcatcgacactgtggtgcgc
ccgacgcgcatggatagcgaaggcctgcttgcgctgccgctgctgcaggcgccgctgcag
gccgttgggctgatcaccgcgcccggcggacgcggcatgctggcaccaacgctggaacag
cgcggtgcgcgcattgtgcgagccgatgtctatcaacgcatcccgctgcgcttgcgcgcg
tcggccatccaggccttatcgcacgcattgccgcgcagcgtgctggccttgagcagcgcc
gaggcactgacgctggtcctacaacagctgccttccgcgctgatcgagaaatggcaacag
cggccggtggtcgcgtccagcgatcgcatgctggatgccgcgcacgctgctggcttcatc
catcgcatgcgtgcagaaggcccactgccaaagcagcttgccgctgctgcggcagcgatc
gtgacaccaccgcgaccttgctga

DBGET integrated database retrieval system