KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4131Help
Entry
XOO4131           CDS       T00235                                 

Definition
disulfide-isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4411686..4413296
Genome map
AA seq 536 aa AA seqDB search
MINLLPPVIAMTLSLRRPSPSSLALLAVLSMLTACDKPAPPAAPSQTHAASTPAPATSIA
WREGDVEDAFAEAKESGKPILLYWGAAWCPPCNRLKATLFKDPAFIARTQQFVAVHLDGD
SEGAQAWGERFGVKAYPTIIVLRTDQSEITRLAGDADNARLAEVLRVAAKSTSTAQQLLD
KALHTPQQLSADDWAVLGNYAWGTDDRLVKPGDAAHVLTQLSTTAPQPALQRSFALAAIS
AAEHPPAASAANRALLEAVLANPAEVRTNLSPLSYVPARLITAASNDAGVRTTLSNALNQ
ALDKVYADTSLPISDRLGTAYARIQLARLAQGQPTEAETEGPQPPLPKDVVDTVHQRVTW
ATDTAKTDEERQSTISTAAALLSDVGDGSGAEQLLLAELPRSRTPYYYMPELANLAEQRG
DKKTALSWLKKAYDSAQGPATRVQWGVMYVNGLIRLSPDDTAGIESAATQVIGELAGQPD
GYRQRTRQRFASLGTTLKTWSKQHRQEGSAVLARLQQKMHSSCNSKNASECASWLS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacctcctgccccctgtgattgccatgacgctgtcgcttcgacgcccctccccg
tcctcgctcgcgctgctggcggtgctgtccatgctcactgcctgcgacaagcccgccccg
cctgcggcgccttcacagacccacgcggcatccacaccggcgcctgctaccagcatcgcc
tggcgcgagggcgacgtggaagatgcctttgccgaagccaaggaaagcggcaagccgatt
ctgttgtactggggcgcggcgtggtgcccgccctgcaaccgcctcaaggcaacgctgttc
aaggacccggccttcatcgcgcgcacccagcagtttgtcgccgtgcacctggatggtgat
tccgaaggcgcgcaggcctggggcgagcgcttcggggtcaaggcctatcccaccatcatc
gtgctacgcacggaccagagcgaaatcacccgtctggccggcgatgccgataatgcgcgc
ctggccgaggtgctgcgggtcgccgcaaagagcaccagcaccgcccagcaattgctcgac
aaggcgctgcatacgccacaacagctcagcgccgacgactgggccgtgctcggcaactat
gcctggggcaccgacgaccggctggtcaaacccggtgatgccgcccacgtgctcacccag
ctgtcgacaacggcaccacagccggcgctgcaacgtagcttcgccctggccgccatcagc
gccgccgagcacccaccggccgccagcgccgccaatcgcgccttgctggaagcggtgttg
gccaacccggcagaagtgcgcaccaatctcagtccgctgagctatgtgcccgcgcgtctg
atcaccgccgccagcaacgatgccggcgtgcgtaccacgctctccaatgcgttgaatcaa
gccttggacaaggtgtacgccgatacgtcgttgccgatttccgaccggcttggcaccgca
tatgcgcgcatccagctggcacgtctggcacaaggccagcccaccgaagccgaaaccgaa
ggcccgcaaccaccgttgccgaaagacgtcgtggacaccgtgcatcagcgcgttacgtgg
gccaccgacacagccaagaccgacgaggagcgccaatccaccatcagcacggctgccgca
ttgctgagcgatgtaggcgatggcagcggagccgagcaattgctgttggccgagttgccg
cgcagcaggacgccgtattactacatgcccgagctggcgaatctggccgagcaacgtggc
gacaagaagaccgcgctgtcgtggctcaagaaggcctatgacagcgcacaaggccctgcc
acgcgcgtgcagtggggcgtgatgtatgtcaatggtctaatccggctcagccccgacgac
actgccggcatcgagagcgccgccacgcaggtgatcggcgagctggccggccaaccggat
ggttaccggcaacgcacacgtcagcgcttcgcctcgcttggcaccacattgaagacctgg
agcaagcagcaccgtcaggaaggcagtgcagtactggcgcgcctgcaacagaaaatgcac
tccagctgcaacagcaagaacgccagcgaatgcgccagctggttgagttga

DBGET integrated database retrieval system