KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4160Help
Entry
XOO4160           CDS       T00235                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01130  Biosynthesis of antibiotics
xoo01230  Biosynthesis of amino acids
Module
xoo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOO4160 (trpC)
Enzymes [BR:xoo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XOO4160 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAW77414
UniProt: Q5GV59
Position
complement(4436064..4437098)
Genome map
AA seq 344 aa AA seqDB search
MACCAHARYSPTARRARGWTPMSPTPTSSPGSPESCRRRNAASITRRHPHSDAGMLRGMQ
LPSSAVILTDNARPPGPNTMSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGF
AAAMQASIAAGDPAVIAEVKKASPSKGVIRPDFHPADIAVSYEFGGATCLSVLTDVDFFQ
GSDAYLRQARDACTLPVLRKDFTVDPYQVYEARVLGADCILLIVSALKDAQLADLSGLAM
QLGLDVLVEVHDVDELERAVQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRDRVLVTE
SGIVTQADVQLMRSNDVNAFLVGETFMRAAEPGESLRQLFFAHD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgctgcgcgcacgcgcggtactcgccgacggctcggcgcgcgcgcggctggacg
cctatgtcgcctacacccaccagctcgccgggcagccctgagtcatgccggcgccgcaac
gctgcgtcaatcacccgccggcatccgcacagtgacgctggcatgctgcgcggcatgcag
ctgccctccagtgcggttatcttgaccgataatgcccgaccgccaggacccaatacgatg
agcgacatcctcaacaccattcttgcccgcaaggccgacgaagtcgccgagcgcagtgcg
cgcgtgccgctggccgagttgatcgcgcgcagcgccgacctgccgctcacgcgcggtttt
gcggctgccatgcaggccagcatcgccgccggcgatccggccgtgattgccgaagtgaag
aaggccagcccgtccaagggcgtgatccggcccgacttccatccggccgatatcgcggtc
agctatgagttcggcggcgcgacgtgcctgtcggtgctcaccgatgtggatttcttccag
ggatccgatgcctatctacggcaggcgcgcgacgcctgcaccctgccggtgctgcgcaag
gatttcaccgtcgacccgtatcaggtctatgaagcccgcgtgctcggtgccgactgcatc
ctgttgatcgtctccgcattgaaagatgcccaattggccgatttgtcggggctggccatg
cagctgggcctggacgtgctggtggaagtgcacgatgtcgacgagctcgagcgtgcggtg
caggtgccggtgccgttgatcggcatcaataatcgcaacctgcgcactttcgaggtcacg
ctgcagaccaccctggacatgcgcgccgcggtgccgcgcgaccgcgtgctggttaccgaa
agcggcatcgtcacccaggccgatgtgcaactgatgcgcagcaacgatgtgaacgcgttt
ctggttggcgagaccttcatgcgcgcggccgaacccggcgagtcactgcgtcagctattc
ttcgcgcatgactga

DBGET integrated database retrieval system