KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4160Help
Entry
XOO4160           CDS       T00235                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XOO4160 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOO4160 (trpC)
Enzymes [BR:xoo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XOO4160 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4436064..4437098)
Genome map
AA seq 344 aa AA seqDB search
MACCAHARYSPTARRARGWTPMSPTPTSSPGSPESCRRRNAASITRRHPHSDAGMLRGMQ
LPSSAVILTDNARPPGPNTMSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGF
AAAMQASIAAGDPAVIAEVKKASPSKGVIRPDFHPADIAVSYEFGGATCLSVLTDVDFFQ
GSDAYLRQARDACTLPVLRKDFTVDPYQVYEARVLGADCILLIVSALKDAQLADLSGLAM
QLGLDVLVEVHDVDELERAVQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRDRVLVTE
SGIVTQADVQLMRSNDVNAFLVGETFMRAAEPGESLRQLFFAHD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgctgcgcgcacgcgcggtactcgccgacggctcggcgcgcgcgcggctggacg
cctatgtcgcctacacccaccagctcgccgggcagccctgagtcatgccggcgccgcaac
gctgcgtcaatcacccgccggcatccgcacagtgacgctggcatgctgcgcggcatgcag
ctgccctccagtgcggttatcttgaccgataatgcccgaccgccaggacccaatacgatg
agcgacatcctcaacaccattcttgcccgcaaggccgacgaagtcgccgagcgcagtgcg
cgcgtgccgctggccgagttgatcgcgcgcagcgccgacctgccgctcacgcgcggtttt
gcggctgccatgcaggccagcatcgccgccggcgatccggccgtgattgccgaagtgaag
aaggccagcccgtccaagggcgtgatccggcccgacttccatccggccgatatcgcggtc
agctatgagttcggcggcgcgacgtgcctgtcggtgctcaccgatgtggatttcttccag
ggatccgatgcctatctacggcaggcgcgcgacgcctgcaccctgccggtgctgcgcaag
gatttcaccgtcgacccgtatcaggtctatgaagcccgcgtgctcggtgccgactgcatc
ctgttgatcgtctccgcattgaaagatgcccaattggccgatttgtcggggctggccatg
cagctgggcctggacgtgctggtggaagtgcacgatgtcgacgagctcgagcgtgcggtg
caggtgccggtgccgttgatcggcatcaataatcgcaacctgcgcactttcgaggtcacg
ctgcagaccaccctggacatgcgcgccgcggtgccgcgcgaccgcgtgctggttaccgaa
agcggcatcgtcacccaggccgatgtgcaactgatgcgcagcaacgatgtgaacgcgttt
ctggttggcgagaccttcatgcgcgcggccgaacccggcgagtcactgcgtcagctattc
ttcgcgcatgactga

DBGET integrated database retrieval system