KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4160Help
Entry
XOO4160           CDS       T00235                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xoo01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:xoo00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4436064..4436861)
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAMQASIAAGDPAVIAEV
KKASPSKGVIRPDFHPADIAVSYEFGGATCLSVLTDVDFFQGSDAYLRQARDACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALKDAQLADLSGLAMQLGLDVLVEVHDVDELERA
VQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRDRVLVTESGIVTQADVQLMRSNDVNA
FLVGETFMRAAEPGESLRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcaacaccattcttgcccgcaaggccgacgaagtcgccgagcgcagt
gcgcgcgtgccgctggccgagttgatcgcgcgcagcgccgacctgccgctcacgcgcggt
tttgcggctgccatgcaggccagcatcgccgccggcgatccggccgtgattgccgaagtg
aagaaggccagcccgtccaagggcgtgatccggcccgacttccatccggccgatatcgcg
gtcagctatgagttcggcggcgcgacgtgcctgtcggtgctcaccgatgtggatttcttc
cagggatccgatgcctatctacggcaggcgcgcgacgcctgcaccctgccggtgctgcgc
aaggatttcaccgtcgacccgtatcaggtctatgaagcccgcgtgctcggtgccgactgc
atcctgttgatcgtctccgcattgaaagatgcccaattggccgatttgtcggggctggcc
atgcagctgggcctggacgtgctggtggaagtgcacgatgtcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgttgatcggcatcaataatcgcaacctgcgcactttcgaggtc
acgctgcagaccaccctggacatgcgcgccgcggtgccgcgcgaccgcgtgctggttacc
gaaagcggcatcgtcacccaggccgatgtgcaactgatgcgcagcaacgatgtgaacgcg
tttctggttggcgagaccttcatgcgcgcggccgaacccggcgagtcactgcgtcagcta
ttcttcgcgcatgactga

DBGET integrated database retrieval system