KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4428Help
Entry
XOO4428           CDS       T00235                                 

Definition
secreted xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     XOO4428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4720250..4721227)
Genome map
AA seq 325 aa AA seqDB search
MLKLRYPLTLVLLLGACVSAVAGPIAAGKRRVLGSAYSPQQAQGFTNYWNADVPENAGKW
GSVEAVRGQMNWGPLDQAYQLAKRNHMQFQFHVGLWGAQQPTWVSNLPPHEQLAAIEHWF
AAIAQRYPGIDLMQVANETLPGHNQPDNRRSDTGNYMQALGGTGTTGVDWVLEAFRLARR
YFPHTKLMINDYNVTEYNDQARQYLHTIQLLQQEHLIDAIGIQGHLSSNGPSVAVQRANL
DLLASTRLPIYITEFDLDGRTDAQQLAAWQRFFPMFWEHPAVRGVNLWGFRHGMWRDNEG
AYLINYDGSERPALTWLRRYVASRP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactccgttacccgctcacgcttgtgctgttgctgggcgcttgtgtgtccgct
gttgccgggcctatcgctgccggcaaacgacgcgttctgggcagcgcctacagcccacag
caagcgcagggcttcaccaactactggaacgccgacgttcccgaaaatgccggcaaatgg
ggcagcgtcgaagccgtgcgcggccagatgaactggggcccgctcgatcaggcttaccag
ctggccaagcgtaaccatatgcagttccagttccatgtcgggctctggggcgcccagcag
ccgacgtgggtgagcaacctgccgccacacgagcagcttgctgcgatcgagcactggttt
gccgcgattgcgcagcgctaccccggcatcgacctgatgcaggtggccaacgagacgctg
ccgggtcacaaccagccggacaatcgccgcagcgatacgggcaattatatgcaggcactg
ggcggtaccggcaccactggcgtcgattgggtgcttgaggcattccgcctggcacgcagg
tatttcccccataccaagttgatgatcaatgactacaacgtcaccgagtacaacgaccaa
gccaggcagtatctgcacaccatccagctgctgcagcaagaacacctgatcgatgcgatc
ggtatccaggggcacctctcgagcaacggcccctcagttgcggtgcagcgcgccaacctc
gacctgctggcatccaccaggttgccgatctacatcaccgagtttgacctggatggccgt
accgatgcccagcagctggcagcctggcagcgcttcttcccgatgttctgggagcacccg
gccgtgcgcggtgtgaacctgtggggtttccgtcacggtatgtggcgcgacaacgaaggt
gcctatctgattaattatgatggcagcgaacgcccggcattgacctggctacgcagatac
gttgccagcaggccatga

DBGET integrated database retrieval system