KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4429Help
Entry
XOO4429           CDS       T00235                                 

Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4721645..4722526)
Genome map
AA seq 293 aa AA seqDB search
MARSRRLGLRSTGTSSPGKWRQMGQCGSDARPDDWSTLDAAYRFAQANGMPFQMHVMMWG
NQQPEWIKSVRAVEQRREIAPWFATVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYLQA
LGGSGDSGWEWGLQSFRLARQHVPHTKRMINDYSITNSAQATQKYLQIVRLLQREHLVDA
IGVQKHAFETTPNVAMSVHRDNLDALAATCLPIYITEFDLDGPTDTQQLADYQRVFPLFW
ERPAMHGITLWGFRPGVWRDKEAAYLIRADGTERPALTWLRDYVAAHPGTPTP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcagcaggcgcctgggtttgcgcagcactggaacaagctcaccgggaaaatgg
cggcaaatggggcagtgtggaagcgatgcgcgaccagatgattggagcacgctggatgct
gcttaccggtttgcgcaggccaacggcatgccgttccagatgcacgtgatgatgtggggc
aaccagcagccggagtggatcaagagcgtgcgggcggtcgaacagcgccgcgagatcgcg
ccatggtttgccactgttgcgcagcgctacccggacatcgcgctgctggaggtggtgaac
gaaccgctcaacgacccgccgagcaaggccgataccggtggcggcaattatctgcaggcg
ctgggtggcagcggcgacagtgggtgggaatgggggctgcagtcgtttcggcttgcgcgc
cagcatgtcccgcataccaagcggatgatcaacgactacagcatcaccaatagtgcgcag
gccacacagaaatatctgcagatcgtgcggttgctgcagcgcgagcacttggtcgatgcc
atcggcgtgcagaagcacgccttcgagaccacaccgaatgtggcgatgtcggtgcatcgc
gacaatctggatgcgttggctgccacctgtttgccgatctacatcaccgagttcgacctg
gacgggcccaccgatacgcagcagctggccgactaccagcgcgtgtttccgctgttctgg
gagcgcccggccatgcatggcatcaccttgtggggctttcggcccggcgtgtggcgcgac
aaggaagctgcctacctgatccgcgccgatggcaccgaacgtcccgcgctcacgtggctg
cgtgactacgttgcagcccatcccggcacacctacgccatga

DBGET integrated database retrieval system