KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4429Help
Entry
XOO4429           CDS       T00235                                 

Gene name
XynA
Definition
(GenBank) Beta-1,4-xylanase
  KO
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     XOO4429 (XynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4721645..4722532)
Genome map
AA seq 295 aa AA seqDB search
MRMARSRRLGLRSTGTSSPGKWRQMGQCGSDARPDDWSTLDAAYRFAQANGMPFQMHVMM
WGNQQPEWIKSVRAVEQRREIAPWFATVAQRYPDIALLEVVNEPLNDPPSKADTGGGNYL
QALGGSGDSGWEWGLQSFRLARQHVPHTKRMINDYSITNSAQATQKYLQIVRLLQREHLV
DAIGVQKHAFETTPNVAMSVHRDNLDALAATCLPIYITEFDLDGPTDTQQLADYQRVFPL
FWERPAMHGITLWGFRPGVWRDKEAAYLIRADGTERPALTWLRDYVAAHPGTPTP
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatggcgcgcagcaggcgcctgggtttgcgcagcactggaacaagctcaccggga
aaatggcggcaaatggggcagtgtggaagcgatgcgcgaccagatgattggagcacgctg
gatgctgcttaccggtttgcgcaggccaacggcatgccgttccagatgcacgtgatgatg
tggggcaaccagcagccggagtggatcaagagcgtgcgggcggtcgaacagcgccgcgag
atcgcgccatggtttgccactgttgcgcagcgctacccggacatcgcgctgctggaggtg
gtgaacgaaccgctcaacgacccgccgagcaaggccgataccggtggcggcaattatctg
caggcgctgggtggcagcggcgacagtgggtgggaatgggggctgcagtcgtttcggctt
gcgcgccagcatgtcccgcataccaagcggatgatcaacgactacagcatcaccaatagt
gcgcaggccacacagaaatatctgcagatcgtgcggttgctgcagcgcgagcacttggtc
gatgccatcggcgtgcagaagcacgccttcgagaccacaccgaatgtggcgatgtcggtg
catcgcgacaatctggatgcgttggctgccacctgtttgccgatctacatcaccgagttc
gacctggacgggcccaccgatacgcagcagctggccgactaccagcgcgtgtttccgctg
ttctgggagcgcccggccatgcatggcatcaccttgtggggctttcggcccggcgtgtgg
cgcgacaaggaagctgcctacctgatccgcgccgatggcaccgaacgtcccgcgctcacg
tggctgcgtgactacgttgcagcccatcccggcacacctacgccatga

DBGET integrated database retrieval system