KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4469Help
Entry
XOO4469           CDS       T00235                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XOO4469 (recD)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XOO4469 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4757388..4759697)
Genome map
AA seq 769 aa AA seqDB search
MEHGVAWKDVRPRSAHPMNHPNLLTALNQSGALRTLDLAFAQSLQRLEPETDPQVLAGAA
LASLAVTSGHAGLDPVRAAMLLDARDGPSPPFPDPADWQRCLAASRWVDQPQPEDPAAAD
RPLVLERGLLYLRRYREYERRLALGLQRIAAQTSPPFAATLAPLFAQLFPQATPLPRGEG
ARRAGEGKGLPEPSLQQEGTNPPVLSSNGTNQTAPSPTPDRQAQAAALALRRALLLVTGG
PGTGKTTTIARLLLLRIAQAHASNTPAPRIALAAPTGRAAERMAESLRAAVARAIADGID
PSLADALPTGASTLHRLLGVIPDSPHFRHNADNPLPLDLIVVDEASMVDLPLMCKLVEAV
ADGTQLILLGDADQLPSVEAGDVLAAILQAAGPGDALQPDDAQALQPLLGGAPVGSPRPV
TSHIHTGGLAGHRVHLLRGYRQADDFALAPLADAIRAGDADTALALLRSGELAGVHFHED
GEDPLALGRDALLAHWRVLATARDPAAALRDASRLRLLTAVRAGPQGARGLNARIEQLLA
ETGSGARRLGGASPWFQGRLLLITTNSYRHGLFNGDVGICLRSDPRALPGRSDAGPSPGQ
GDASAVTARGHAAPSSRPGHAGDSAHHDAPATDSRAQGPLVAWFEGDGDGQVRGFHPAAL
PAHESAFAMTVHKAQGSEFDEVWLQLPTRDARVLSRELLYTGITRARRALHLAGSEAVIR
AALARHAARISGLAWRLGAKDDKPQPVPVPTPAPLPQPPPSAPVQGALF
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
gtggagcatggtgtggcatggaaggacgttcgccccaggagcgcccaccccatgaaccac
ccgaatctgctcactgcgctcaaccagagtggcgccctgcgcaccctggatctggccttc
gcgcaaagcctgcaacgcctggaaccggagaccgacccacaggtgctggccggtgccgcg
ctcgcctcgctggccgtcaccagcggccacgccgggctggaccccgtccgcgctgccatg
ttgctggacgcgcgcgatggcccatcgcccccattcccggaccccgccgactggcaacgc
tgcctggccgcctcgcgctgggtcgaccaaccacagcccgaagacccggctgccgccgac
cgcccgctcgtcctcgaacgcggtctgctctacctgcgccgttaccgcgagtacgaacgc
cgcctggccctgggcctgcagcgcatcgccgcccaaacctcgccccccttcgccgccacc
ctggcgccgctgttcgcacagttgttcccgcaagccacccctctcccccggggcgagggt
gcccgcagggcgggtgagggtaagggcctgcccgagccatccctccagcaagagggcaca
aatccgcccgtgctatccagcaacggcacgaaccaaacagcaccatcccccaccccagat
cgccaagcgcaggccgcagccctcgcgctgcgccgcgcgctactgctggtcaccggcggc
cccggcaccggcaaaaccaccaccatcgcccgcctgctgttgctacgcatcgcccaggca
cacgcatccaacaccccggccccacgcatcgccctggccgcacccaccggccgcgccgcc
gagcgcatggccgaaagcctgcgcgccgccgtcgcacgcgccatcgccgacggtatcgac
cccagcctggccgacgccctgcccaccggcgccagcacgctgcaccgtctgctcggcgtc
attccggattccccgcacttccgccacaacgccgacaacccgctgccattggatctgatc
gtcgtcgacgaagcctccatggtcgacctgccgctgatgtgcaaactggtcgaagccgtc
gccgatggcacccagctgatcctgcttggcgacgccgaccagctgccctcggtggaagcc
ggcgacgtgctcgccgccatcctgcaggccgccggccccggcgacgcgttgcagcccgac
gacgcccaggcgttgcaaccgctgctcggcggcgcgcctgtgggcagtccacgcccggtc
acctctcacatccacaccggcggcctggccggtcaccgcgtgcacctgctgcgtggctat
cgccaggcggacgacttcgcactcgccccactggccgacgccatccgcgccggcgatgcc
gacaccgccctggccctgctgcgtagcggcgaactggccggcgtgcacttccacgaagac
ggcgaagacccgctggcactcggccgcgacgcgctgctcgcccactggcgcgtgctggcc
actgcccgagatcccgctgccgcattgcgcgatgcaagccgcctacgcctgctcaccgcg
gtgcgtgccggcccgcaaggcgcacgtggcctcaacgcccgcatcgaacaactgctggcc
gaaaccggctccggcgcccgtcgccttggcggcgcctcgccctggttccagggccgcctg
ctgctgatcaccacaaacagctaccgccacggcctgttcaacggcgacgtcggcatctgt
ctgcgcagcgacccgcgcgccttgcctggccgcagcgacgcgggcccttcccccggccag
ggcgacgcaagtgccgtgaccgcgcgcggccacgcggcaccgtcgtcaaggccgggccac
gctggcgacagcgcacaccatgacgcccccgccaccgacagccgtgcccaaggccccttg
gtcgcctggttcgaaggcgacggcgacggccaggtgcgcggcttccaccccgccgcactg
cccgcgcacgaaagcgccttcgccatgaccgtgcacaaggcccaaggcagcgaattcgac
gaagtctggctgcaactgccgacccgcgacgcccgcgtactcagccgcgaactgctctac
accggcatcacccgcgcccgccgcgccctgcacctggccggcagcgaagcggtcatccgc
gccgcactggcgcgccacgccgcgcggatctcggggttggcgtggcggttgggtgcaaaa
gacgacaagccacagcccgttccagtacccacgccagcgccgcttccacaaccgccgccg
agtgcgcctgtgcaaggtgcgctgttctga

DBGET integrated database retrieval system