KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4469Help
Entry
XOO4469           CDS       T00235                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XOO4469 (recD)
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XOO4469 (recD)
DNA repair and recombination proteins [BR:xoo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XOO4469 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD UvrD-helicase AAA_22 UvrD_C T2SSE AAA_16 DEAD AAA_28 DUF2075 AAA_29
Motif
Other DBs
NCBI-ProteinID: AAW77723
UniProt: Q5GUA0
Position
complement(4757388..4759697)
Genome map
AA seq 769 aa AA seqDB search
MEHGVAWKDVRPRSAHPMNHPNLLTALNQSGALRTLDLAFAQSLQRLEPETDPQVLAGAA
LASLAVTSGHAGLDPVRAAMLLDARDGPSPPFPDPADWQRCLAASRWVDQPQPEDPAAAD
RPLVLERGLLYLRRYREYERRLALGLQRIAAQTSPPFAATLAPLFAQLFPQATPLPRGEG
ARRAGEGKGLPEPSLQQEGTNPPVLSSNGTNQTAPSPTPDRQAQAAALALRRALLLVTGG
PGTGKTTTIARLLLLRIAQAHASNTPAPRIALAAPTGRAAERMAESLRAAVARAIADGID
PSLADALPTGASTLHRLLGVIPDSPHFRHNADNPLPLDLIVVDEASMVDLPLMCKLVEAV
ADGTQLILLGDADQLPSVEAGDVLAAILQAAGPGDALQPDDAQALQPLLGGAPVGSPRPV
TSHIHTGGLAGHRVHLLRGYRQADDFALAPLADAIRAGDADTALALLRSGELAGVHFHED
GEDPLALGRDALLAHWRVLATARDPAAALRDASRLRLLTAVRAGPQGARGLNARIEQLLA
ETGSGARRLGGASPWFQGRLLLITTNSYRHGLFNGDVGICLRSDPRALPGRSDAGPSPGQ
GDASAVTARGHAAPSSRPGHAGDSAHHDAPATDSRAQGPLVAWFEGDGDGQVRGFHPAAL
PAHESAFAMTVHKAQGSEFDEVWLQLPTRDARVLSRELLYTGITRARRALHLAGSEAVIR
AALARHAARISGLAWRLGAKDDKPQPVPVPTPAPLPQPPPSAPVQGALF
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
gtggagcatggtgtggcatggaaggacgttcgccccaggagcgcccaccccatgaaccac
ccgaatctgctcactgcgctcaaccagagtggcgccctgcgcaccctggatctggccttc
gcgcaaagcctgcaacgcctggaaccggagaccgacccacaggtgctggccggtgccgcg
ctcgcctcgctggccgtcaccagcggccacgccgggctggaccccgtccgcgctgccatg
ttgctggacgcgcgcgatggcccatcgcccccattcccggaccccgccgactggcaacgc
tgcctggccgcctcgcgctgggtcgaccaaccacagcccgaagacccggctgccgccgac
cgcccgctcgtcctcgaacgcggtctgctctacctgcgccgttaccgcgagtacgaacgc
cgcctggccctgggcctgcagcgcatcgccgcccaaacctcgccccccttcgccgccacc
ctggcgccgctgttcgcacagttgttcccgcaagccacccctctcccccggggcgagggt
gcccgcagggcgggtgagggtaagggcctgcccgagccatccctccagcaagagggcaca
aatccgcccgtgctatccagcaacggcacgaaccaaacagcaccatcccccaccccagat
cgccaagcgcaggccgcagccctcgcgctgcgccgcgcgctactgctggtcaccggcggc
cccggcaccggcaaaaccaccaccatcgcccgcctgctgttgctacgcatcgcccaggca
cacgcatccaacaccccggccccacgcatcgccctggccgcacccaccggccgcgccgcc
gagcgcatggccgaaagcctgcgcgccgccgtcgcacgcgccatcgccgacggtatcgac
cccagcctggccgacgccctgcccaccggcgccagcacgctgcaccgtctgctcggcgtc
attccggattccccgcacttccgccacaacgccgacaacccgctgccattggatctgatc
gtcgtcgacgaagcctccatggtcgacctgccgctgatgtgcaaactggtcgaagccgtc
gccgatggcacccagctgatcctgcttggcgacgccgaccagctgccctcggtggaagcc
ggcgacgtgctcgccgccatcctgcaggccgccggccccggcgacgcgttgcagcccgac
gacgcccaggcgttgcaaccgctgctcggcggcgcgcctgtgggcagtccacgcccggtc
acctctcacatccacaccggcggcctggccggtcaccgcgtgcacctgctgcgtggctat
cgccaggcggacgacttcgcactcgccccactggccgacgccatccgcgccggcgatgcc
gacaccgccctggccctgctgcgtagcggcgaactggccggcgtgcacttccacgaagac
ggcgaagacccgctggcactcggccgcgacgcgctgctcgcccactggcgcgtgctggcc
actgcccgagatcccgctgccgcattgcgcgatgcaagccgcctacgcctgctcaccgcg
gtgcgtgccggcccgcaaggcgcacgtggcctcaacgcccgcatcgaacaactgctggcc
gaaaccggctccggcgcccgtcgccttggcggcgcctcgccctggttccagggccgcctg
ctgctgatcaccacaaacagctaccgccacggcctgttcaacggcgacgtcggcatctgt
ctgcgcagcgacccgcgcgccttgcctggccgcagcgacgcgggcccttcccccggccag
ggcgacgcaagtgccgtgaccgcgcgcggccacgcggcaccgtcgtcaaggccgggccac
gctggcgacagcgcacaccatgacgcccccgccaccgacagccgtgcccaaggccccttg
gtcgcctggttcgaaggcgacggcgacggccaggtgcgcggcttccaccccgccgcactg
cccgcgcacgaaagcgccttcgccatgaccgtgcacaaggcccaaggcagcgaattcgac
gaagtctggctgcaactgccgacccgcgacgcccgcgtactcagccgcgaactgctctac
accggcatcacccgcgcccgccgcgccctgcacctggccggcagcgaagcggtcatccgc
gccgcactggcgcgccacgccgcgcggatctcggggttggcgtggcggttgggtgcaaaa
gacgacaagccacagcccgttccagtacccacgccagcgccgcttccacaaccgccgccg
agtgcgcctgtgcaaggtgcgctgttctga

DBGET integrated database retrieval system