KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4514Help
Entry
XOO4514           CDS       T00235                                 

Gene name
OLE1
Definition
(GenBank) Fatty-acid desaturase
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XOO4514 (OLE1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XOO4514 (OLE1)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XOO4514 (OLE1)
Lipid biosynthesis proteins [BR:xoo01004]
 Desaturase
  First
   XOO4514 (OLE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4813625..4814890)
Genome map
AA seq 421 aa AA seqDB search
MPRSPPSCLHQPESAAVEMPMLSEPLIDFLTSGVARLGVWGMLAVLLVFTQLTIFAVTLY
LHRSQAHRGVDFHPVIAHFFRFWTWFTTSMISREWVAIHRKHHAKVETEEDPHSPQSKGI
SQVFWRGVELYREARTQRADIEQYGKAAPTDWIERHLYTPHANAGPVALLVINSVLFGLP
GIALWAVQMAWIPFWAAGVVNVLGHWWGYRNFESADTSTNLTPWALRIGGEELHTHHHAF
PSSARFSMRRWELDIGWVVIRSVQAFGLAKVLRVAPSLDIRPNIAVLDADTLKPLLSHRF
QAMTDYQRNVLKPALREEAAATGAKLRELLPRRLRKGLVDDGRWLKPEARAQLQTWVAQR
PRMRTLVEYRARLTAVLEARSHDASERLRQLQQWCHEAEASGNAALQAYAARLKGDALSG
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgatcgcccccatcatgtctgcaccaacccgagagcgctgctgtggagatgccg
atgttgtccgaaccgctcatcgactttttgacgtcaggcgttgcaaggctgggtgtgtgg
ggcatgctggcggtgctgctggtgttcactcagctcaccatctttgcggtgaccttgtac
ctgcatcgcagccaggcgcatcgcggtgtggatttccacccggtcattgcgcattttttc
cgcttctggacctggtttactacctcgatgatcagccgcgagtgggtggcgatccatcgc
aagcaccacgccaaggtcgagaccgaagaagacccgcacagcccgcagagcaaaggcatc
tcgcaggtgttctggcgcggcgtggagttgtaccgcgaggcgcgcacgcagcgcgccgat
atcgagcagtacggtaaggccgcgccgaccgactggatcgagcggcacctgtacacgccg
catgccaacgcaggcccggtcgccttgctggtgatcaactcggtgttgttcgggttgccg
ggtatcgcgttgtgggcggtccagatggcgtggattccgttctgggccgccggtgtggtc
aacgtcctgggccactggtggggctaccgcaacttcgaatcggccgacacctccaccaac
ctcacgccttgggcgctgcggatcggtggcgaagaattgcacacccaccatcatgccttc
ccgagttcggcacgcttttcgatgcggcgttgggagctggatatcggttgggtcgtcatt
cgcagcgtgcaggcgtttggcctggccaaggtgttgcgggtggcgccgtcgctggatatc
cgaccgaatatcgccgtgctcgatgccgatacgctcaagccgctgttgtcgcaccgcttc
caggcaatgaccgactatcagcgcaatgtgctcaagcctgcattgcgcgaagaggcggct
gctaccggcgccaagctgcgcgagttgctgccgcgccgcttgcgcaagggtctggtcgat
gacgggcgctggctcaaaccggaggcacgcgcgcagttgcagacctgggtggcgcagcgt
ccgcgcatgcgcaccctggtcgagtaccgtgcgcggctgacggccgtgctggaagcgcgc
agccacgatgcctccgaacggctcaggcagttgcagcagtggtgccatgaggccgaagcc
agcggcaatgccgccttgcaggcgtatgcagcgcggctcaaaggggatgcgctgagtggc
gcctaa

DBGET integrated database retrieval system