KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4575Help
Entry
XOO4575           CDS       T00235                                 

Gene name
btuE
Definition
(GenBank) ABC transporter vitamin B12 uptake permease
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00480  Glutathione metabolism
xoo00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XOO4575 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XOO4575 (btuE)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XOO4575 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Imm27
Motif
Other DBs
NCBI-ProteinID: AAW77829
UniProt: Q5GTZ4
Position
4877952..4878569
Genome map
AA seq 205 aa AA seqDB search
MNQTLYDIPVTRIEGGPATLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEV
LAFPANDFNGQEPGSEAEIAQFCRLTYDVTFPMFAKIAVTGEQAHPLYQALTSTHPHTTG
DGPMREKLAGYGIAPNPRARRVVELRKIPDRPRRQDHRPLRPGYPRRRCTPASGNRHGVG
GLNLAILLGVSSACIAGEIALRCLS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacgctgtacgacattccggtgacccgcatcgaaggcggtccggccaccttg
gccgactaccgcggcaaggtgttgctggtggtcaacgtcgcctccaagtgcggcctgacc
ccgcagtacgaagggctggaagcgctgtatcgcgacaagcgcgcacagggcctggaagta
ctggcgtttccggccaacgacttcaacggccaggagccaggcagcgaagcggagatcgcg
cagttctgccggctcacctacgatgtcacctttccgatgtttgccaagatcgccgtcacc
ggcgagcaggcgcatccgctgtatcaggcactgaccagcacgcatccgcacaccaccggc
gacggcccgatgcgggaaaaactggccggctacggcatcgcccccaacccccgcgcccgg
cgtgttgtggaacttcgaaaaattcctgatcggccgcgacggcaagatcatcgaccgctt
cgccccggatatccccgccgacgatgcacgcctgcttcaggcaatcgacacggcgttggt
ggtttaaatctcgcgattcttttaggggtaagcagcgcgtgcattgccggtgaaatagcg
cttcggtgtctcagctaa

DBGET integrated database retrieval system