KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4575Help
Entry
XOO4575           CDS       T00235                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xoo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xoo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4877952..4878569
Genome map
AA seq 205 aa AA seqDB search
MNQTLYDIPVTRIEGGPATLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEV
LAFPANDFNGQEPGSEAEIAQFCRLTYDVTFPMFAKIAVTGEQAHPLYQALTSTHPHTTG
DGPMREKLAGYGIAPNPRARRVVELRKIPDRPRRQDHRPLRPGYPRRRCTPASGNRHGVG
GLNLAILLGVSSACIAGEIALRCLS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacgctgtacgacattccggtgacccgcatcgaaggcggtccggccaccttg
gccgactaccgcggcaaggtgttgctggtggtcaacgtcgcctccaagtgcggcctgacc
ccgcagtacgaagggctggaagcgctgtatcgcgacaagcgcgcacagggcctggaagta
ctggcgtttccggccaacgacttcaacggccaggagccaggcagcgaagcggagatcgcg
cagttctgccggctcacctacgatgtcacctttccgatgtttgccaagatcgccgtcacc
ggcgagcaggcgcatccgctgtatcaggcactgaccagcacgcatccgcacaccaccggc
gacggcccgatgcgggaaaaactggccggctacggcatcgcccccaacccccgcgcccgg
cgtgttgtggaacttcgaaaaattcctgatcggccgcgacggcaagatcatcgaccgctt
cgccccggatatccccgccgacgatgcacgcctgcttcaggcaatcgacacggcgttggt
ggtttaaatctcgcgattcttttaggggtaagcagcgcgtgcattgccggtgaaatagcg
cttcggtgtctcagctaa

DBGET integrated database retrieval system