KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00157Help
Entry
PXO_00157         CDS       T00763                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00790  Folate biosynthesis
xop01100  Metabolic pathways
Module
xop_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PXO_00157 (folP)
Enzymes [BR:xop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PXO_00157 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACD58310
UniProt: A0A0K0GJE3
Position
1714776..1715699
Genome map
AA seq 307 aa AA seqDB search
MTQETSWMFDTALTLDCAGRSLRLDTPQVMGIVNVTPDSFSDGGQHASCEAAIAHGLALV
EQGAAVLDIGGESTRPGATPVSVEEELQRVIPVIEALAQRTRVPISVDTFKPEVMRAAVA
AGAGMINDVYALRSPGALEAASDLRVPVVLMHARSAPHAMQDAPQYDDVVGEVHRFLAER
IFAAEMAGIDKRRLILDPGFGFDKTTTHNLALLAQLQRLQEFGLPVLAGLSRKRSIGELT
GREVAAERVHGSVAAHLIAAQHGALLLRVHDVAATVDALKVWNAMAAIPVPRVSAPVAPT
IRWPDED
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggagacatcgtggatgttcgataccgccctcacactggattgcgccggccgc
agcctgcggctggatacgccgcaggtgatgggtatcgtcaatgtcacgcccgattcgttc
tccgacggcggccagcatgccagctgcgaagcggcgatcgcgcatggactggcgctggtg
gagcagggtgctgcggtgttggatatcggcggtgagtccacacgcccgggtgccacgccg
gtatcggttgaagaagaactgcagcgggtgattccggtcatcgaagcactggcgcaacgc
acccgcgtgccgatcagcgtggatacgttcaaaccggaggtcatgcgtgcagcggtcgcg
gccggcgcgggcatgatcaacgacgtgtatgcactgcgttcgcccggtgcactggaggcg
gcgtcggacctgcgcgtgccggtggtcttgatgcatgcgcgcagcgcgccgcacgccatg
caagatgcgccgcagtacgacgatgtggtgggggaagtccaccgctttctggccgagcgc
atcttcgccgccgagatggccggcatcgacaagcgccggctgatcctggaccctggtttc
ggcttcgacaagaccaccacgcacaacctcgccctgcttgcgcagctgcagcgcctgcag
gaattcggcttgccggtattggccgggctgtcgcgcaaacgcagcatcggcgaattgacc
gggcgtgaggttgccgccgaacgtgtgcatggctcggtggccgcccatctgatcgccgcc
cagcacggcgcgctgctgttgcgcgtgcacgatgtggcggccaccgtggatgcgttgaag
gtatggaacgcgatggcggcgattccggtcccgcgtgtcagcgcgccggtcgcaccgacc
atccgttggccggacgaggactga

DBGET integrated database retrieval system