KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00157Help
Entry
PXO_00157         CDS       T00763                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xop00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1714774..1715697
Genome map
AA seq 307 aa AA seqDB search
MTQETSWMFDTALTLDCAGRSLRLDTPQVMGIVNVTPDSFSDGGQHASCEAAIAHGLALV
EQGAAVLDIGGESTRPGATPVSVEEELQRVIPVIEALAQRTRVPISVDTFKPEVMRAAVA
AGAGMINDVYALRSPGALEAASDLRVPVVLMHARSAPHAMQDAPQYDDVVGEVHRFLAER
IFAAEMAGIDKRRLILDPGFGFDKTTTHNLALLAQLQRLQEFGLPVLAGLSRKRSIGELT
GREVAAERVHGSVAAHLIAAQHGALLLRVHDVAATVDALKVWNAMAAIPVPRVSAPVAPT
IRWPDED
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggagacatcgtggatgttcgataccgccctcacactggattgcgccggccgc
agcctgcggctggatacgccgcaggtgatgggtatcgtcaatgtcacgcccgattcgttc
tccgacggcggccagcatgccagctgcgaagcggcgatcgcgcatggactggcgctggtg
gagcagggtgctgcggtgttggatatcggcggtgagtccacacgcccgggtgccacgccg
gtatcggttgaagaagaactgcagcgggtgattccggtcatcgaagcactggcgcaacgc
acccgcgtgccgatcagcgtggatacgttcaaaccggaggtcatgcgtgcagcggtcgcg
gccggcgcgggcatgatcaacgacgtgtatgcactgcgttcgcccggtgcactggaggcg
gcgtcggacctgcgcgtgccggtggtcttgatgcatgcgcgcagcgcgccgcacgccatg
caagatgcgccgcagtacgacgatgtggtgggggaagtccaccgctttctggccgagcgc
atcttcgccgccgagatggccggcatcgacaagcgccggctgatcctggaccctggtttc
ggcttcgacaagaccaccacgcacaacctcgccctgcttgcgcagctgcagcgcctgcag
gaattcggcttgccggtattggccgggctgtcgcgcaaacgcagcatcggcgaattgacc
gggcgtgaggttgccgccgaacgtgtgcatggctcggtggccgcccatctgatcgccgcc
cagcacggcgcgctgctgttgcgcgtgcacgatgtggcggccaccgtggatgcgttgaag
gtatggaacgcgatggcggcgattccggtcccgcgtgtcagcgcgccggtcgcaccgacc
atccgttggccggacgaggactga

DBGET integrated database retrieval system