KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00164Help
Entry
PXO_00164         CDS       T00763                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
Enzymes [BR:xop01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PXO_00164 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1709007..1709684
Genome map
AA seq 225 aa AA seqDB search
MTPRLRLQPESVGIGMTSQRVRDRLVERLREAGIHDEATLNAMQTVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVTPTKVLEVGTGSGYQGAILAALGLEVYTVE
RIGDLLRQARKRFRHLGMNVRSKHDDGRIGWHEHGPYDAIVVTAAAPALVDALVDQLAVG
GRLVAPVGGASSQSLVQLTRGADGTIEQQVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaggctgcgcctgcaaccggagtcggtcggaatcggcatgacctcgcagcgc
gtgcgcgaccgcctggtcgaacggctgcgcgaggctggcatccacgacgaggcgacgctc
aacgcgatgcagaccgtgccgcggcacttgttcatcgatgaagcgctggcctcgcgcgcg
tacgaagacaccgcgctgccgatcggccacggccagaccatctcgcagccatgggtggtg
gcgcgcatgaccgaggcagtgctgcaagtgacgccgaccaaggtgctcgaagtgggcacc
ggctccggctaccagggcgcgattctggcggcgctggggctggaggtgtacaccgtcgag
cgcattggcgatctgttacggcaagcgcgcaagcgctttcggcatctgggcatgaacgtg
cgcagcaagcacgacgacggccgtatcggctggcacgagcacggcccctatgacgccatc
gtggtgaccgccgccgcaccggcgctggtcgatgcgctggtcgatcagctggcggtcggt
ggacgcctggtcgctccggtcggcggcgcttcctcgcaatcgctggtgcaactcacacgc
ggcgccgatggcaccatcgaacaacaggttctggcgccggtcacgttcgtcccgctgttg
tcgggcatgctggattga

DBGET integrated database retrieval system