KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00210Help
Entry
PXO_00210         CDS       T00763                                 

Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xop00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xop02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1662842..1663183)
Genome map
AA seq 113 aa AA seqDB search
MLAGALPVPSARAADGAGTFLTECGECHSAKQGKNKKGPSLFGVAGRPAGTVADFSGYSD
ALKNSKWTWTPAQLKTYLSHSSTKALPGTKMKYDGLDDPKELDALITYLNTLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
ttgctggcaggcgcactgcccgtgccatcggcacgcgctgccgacggtgccggcaccttc
ctcaccgaatgcggcgaatgccatagcgccaaacagggcaaaaacaagaaaggcccgtcc
ctgttcggcgtggccggccgccctgccggcaccgtggctgatttcagcggttactccgac
gcgctcaagaacagcaagtggacctggaccccggcccagctcaagacctacttgtcgcac
tcctcgaccaaggccctgccaggtaccaagatgaagtacgacggcctggacgatccgaag
gagctcgacgcgttgatcacctacctcaacaccttgaagtag

DBGET integrated database retrieval system