KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00242Help
Entry
PXO_00242         CDS       T00763                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PXO_00242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1623820..1624812)
Genome map
AA seq 330 aa AA seqDB search
MTQPPSPARPDHRTQRWTPVAIMKVAFASTAFLAMPSMQAAGVAAPSVRPNEPIHVIQPA
TGLDSRKVALGALLFNDRRLSGDNRLACTSCHRLSSNGAAADATTRTPGRAPPAFNTPTI
FNATANFRLGWRGNFRSLEVHTASLLEKPSVMQADIATVVGRLRQDTVLNQRFRAAYGRP
PDRAALFDAIASYERSLVTPGSRFDLWLQGSDTALNAQELRGYRTFKSIGCISCHQGVNV
GGNLFQRSGIFAPVTRDGTPILRVPSLRNVATTAPYFHDGSASTLPQAIKAMGTAQLGVA
LSPADVSDIAAFLNTLTGKHQGRQLTAPHP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgccgtcgccggctcggccagaccatcgcacacagcgctggacgccggtg
gcgatcatgaaggtcgcgttcgcttccacagcgttcctcgcgatgccgtccatgcaggca
gctggcgttgcagccccgtcggtgcgccctaatgagcccatccatgtcatccaaccagca
accggcctggacagccgcaaggtcgcgctgggcgcactgctgttcaatgatcgccggctg
tcgggcgataaccgccttgcctgcacgtcttgtcatcgcctgtccagcaacggtgccgct
gccgatgcgacgacccggacgcccgggcgcgcgccgccggcgttcaatacaccgaccatt
ttcaatgcgacagcgaactttcgcctgggctggcgcggcaacttccgcagtctggaagtg
cacacggcttcactgctcgaaaagccaagcgtcatgcaggccgatatcgcgacggtggtc
ggacgactgcgacaagacacggtgctcaatcagcgctttcgcgcggcctatggcaggcca
ccggatcgcgccgcgctgttcgatgccatcgccagctacgaacgctcgctggtcacgccg
ggcagtcgcttcgacctctggctgcaaggcagcgacacggcattgaacgcacaagagtta
cgcggctatcgcaccttcaagtcgatcggctgcatttcctgccaccaaggcgtcaacgtg
ggcggcaatctgttccagcgcagcggcatcttcgctcccgtcacacgggatggcaccccg
atcctgcgggttcccagcctgcgtaacgttgccacgaccgccccgtacttccacgacggc
agcgccagcaccctgccccaggcgatcaaggcgatgggcaccgctcaacttggcgtcgca
ctgagccctgcggatgtctccgatatcgctgcgtttctgaacacattgaccggcaagcac
cagggtcggcagctgacggcgccccacccatga

DBGET integrated database retrieval system