KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00343Help
Entry
PXO_00343         CDS       T00763                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xop01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xop00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2055191..2056345
Genome map
AA seq 384 aa AA seqDB search
MSTPASTSSPFAEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREL
VIVSSGAVAAGRAILPKAVDVGAPIAARQALAALGQAQLIALWQRFFERAVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDDVPELTPEVLAMAGGSGSNVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSGEVVRALAQDRLRGTRIHAARTRIAARKYWLRHAPVEAGAILVDAGAAM
ALSDKGASLLPGGVVGAEGDFRRGDMVEIRLRDDEGERCLARGVSQYSAVDIRRIARRHS
RDIENVLGYSYGENVVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccagccagcacgtcgtcgccctttgccgagcaggcactgccgccgtggcgg
cgtgccgtgctcaaggtcggcagtagcctgcttgctgccgatggcggtggcctgtcgccg
cgtttcgcattggggctggcgcagttcgtctctgctaacctggcggcggggcgcgagctg
gtgatcgtgtcgtcgggcgcagtggcggcgggccgcgccatcctgccgaaagcggtggat
gtcggcgcgccgatcgcggcacgtcaagcgctggctgcgctcggccaggcgcagttgatc
gcgctgtggcagcgctttttcgagcgcgcggtggcgcaggtgctgctcacccatgacgat
ctgcgcaaccgtcgccgctatctcaatgcacgcgccacattgggcgagttgttgcggttg
ggcgcgttgccggtgatcaacgaaaacgacaccgtttcggtggatgagttgaagctgggc
gataacgacaacctggccgcaatcgtggccgccttggtcgatgccgatgccttgttcatc
gccactgatatcgacggcttgtatagcgccgacccacgcagtaaccccttggcgcggccg
ctcgacgatgtgcccgagctcacgccggaggtgctggcgatggctggcggcagcggcagc
aatgtaggcaccggcggcatgcgcaccaaattggaagccgctgcaaaggcgggtgcggcc
ggcatcgaaacctatctgttcaacggccgcagtggcgaggtggtgcgcgccctggcgcag
gaccgcctgcgtggcacgcgcatccatgccgcacgcacgcgcattgccgcacgcaagtac
tggctacggcacgcgccggtggaagcgggcgcgattctggtcgatgccggcgcagcaatg
gcgctgagcgacaagggcgcctcgctgttgccgggcggtgtggtcggtgccgagggcgat
ttccgccgcggcgacatggtggagattcgcctgcgtgatgacgagggcgaacgttgtctg
gcacgcggcgtcagccagtattcggcagtggatatccgtcgcatcgcacgccgccactcg
cgcgacatcgagaacgtactcggttacagctatggcgagaacgtggtgcatcgcgatgat
ttggtgttgttgtag

DBGET integrated database retrieval system