KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00343Help
Entry
PXO_00343         CDS       T00763                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PXO_00343 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PXO_00343 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PXO_00343 (proB)
Enzymes [BR:xop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PXO_00343 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2055191..2056345
Genome map
AA seq 384 aa AA seqDB search
MSTPASTSSPFAEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFVSANLAAGREL
VIVSSGAVAAGRAILPKAVDVGAPIAARQALAALGQAQLIALWQRFFERAVAQVLLTHDD
LRNRRRYLNARATLGELLRLGALPVINENDTVSVDELKLGDNDNLAAIVAALVDADALFI
ATDIDGLYSADPRSNPLARPLDDVPELTPEVLAMAGGSGSNVGTGGMRTKLEAAAKAGAA
GIETYLFNGRSGEVVRALAQDRLRGTRIHAARTRIAARKYWLRHAPVEAGAILVDAGAAM
ALSDKGASLLPGGVVGAEGDFRRGDMVEIRLRDDEGERCLARGVSQYSAVDIRRIARRHS
RDIENVLGYSYGENVVHRDDLVLL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccagccagcacgtcgtcgccctttgccgagcaggcactgccgccgtggcgg
cgtgccgtgctcaaggtcggcagtagcctgcttgctgccgatggcggtggcctgtcgccg
cgtttcgcattggggctggcgcagttcgtctctgctaacctggcggcggggcgcgagctg
gtgatcgtgtcgtcgggcgcagtggcggcgggccgcgccatcctgccgaaagcggtggat
gtcggcgcgccgatcgcggcacgtcaagcgctggctgcgctcggccaggcgcagttgatc
gcgctgtggcagcgctttttcgagcgcgcggtggcgcaggtgctgctcacccatgacgat
ctgcgcaaccgtcgccgctatctcaatgcacgcgccacattgggcgagttgttgcggttg
ggcgcgttgccggtgatcaacgaaaacgacaccgtttcggtggatgagttgaagctgggc
gataacgacaacctggccgcaatcgtggccgccttggtcgatgccgatgccttgttcatc
gccactgatatcgacggcttgtatagcgccgacccacgcagtaaccccttggcgcggccg
ctcgacgatgtgcccgagctcacgccggaggtgctggcgatggctggcggcagcggcagc
aatgtaggcaccggcggcatgcgcaccaaattggaagccgctgcaaaggcgggtgcggcc
ggcatcgaaacctatctgttcaacggccgcagtggcgaggtggtgcgcgccctggcgcag
gaccgcctgcgtggcacgcgcatccatgccgcacgcacgcgcattgccgcacgcaagtac
tggctacggcacgcgccggtggaagcgggcgcgattctggtcgatgccggcgcagcaatg
gcgctgagcgacaagggcgcctcgctgttgccgggcggtgtggtcggtgccgagggcgat
ttccgccgcggcgacatggtggagattcgcctgcgtgatgacgagggcgaacgttgtctg
gcacgcggcgtcagccagtattcggcagtggatatccgtcgcatcgcacgccgccactcg
cgcgacatcgagaacgtactcggttacagctatggcgagaacgtggtgcatcgcgatgat
ttggtgttgttgtag

DBGET integrated database retrieval system