KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00373Help
Entry
PXO_00373         CDS       T00763                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PXO_00373
   00500 Starch and sucrose metabolism
    PXO_00373
Enzymes [BR:xop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PXO_00373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2028047..2029228)
Genome map
AA seq 393 aa AA seqDB search
MSESHIRTTCLATALLSLVSANAMALTGTATRPQLTTSEASTYTITKALAKAGPITALVT
DNWNPTAGVALLSADYAVAADGSTPYRTVQAAIDAAVAAGGTTRRYISIKAGTYTGLVCV
PTNAPPLTVFGLGTDSTDTVIRFNNANPTPKPTGIASHPCASNAAATTVGTSNSATLTVR
AAGFQARHLRVDNDYVEGTYTDNNQSAVALAVRGDKASFEDVVITGNQDTLLISATNAAN
VIRSYFKNSTIEGDVDFIFGSGVGVFDNALIRSAGARLGSSSGGYIFAPSTRPGSPYGFL
AINSRFVAGSGSPDNQTYLGRAWDEGVRGLSAYVNGTSPNGQVTVRDSNLGSHIRKTAPW
DASTASRPYCSSNCTNSANRFYEYGNSGAGAGN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatcgcacatccgtacgacctgcctcgccaccgcactgttgagccttgtcagc
gccaatgcgatggcattgaccggcaccgccacgcgaccgcaactcaccactagcgaagca
agcacctacaccatcacaaaagccttggccaaggccggaccgatcactgcgctggtgacc
gacaattggaatcccacggcaggcgttgccttgctcagcgccgattacgcagtggctgcc
gacggctcgacaccctaccgcaccgtgcaggcggctattgatgcggcggttgctgcaggc
ggcaccacacgtcgctacatcagcatcaaggcgggcacctacaccggactggtgtgcgtg
cccaccaatgcgccaccactgacggtgttcgggctgggcaccgacagcacagatacggtc
atccgcttcaacaatgccaaccccactcccaaaccgactggcatcgcaagccacccttgc
gcaagcaatgcagcggcaaccacggtgggcacgtccaatagcgctacgttgacggtgcgc
gcagcaggcttccaggcgcgtcacctgcgcgtggacaacgactatgtcgaaggcacttac
acagacaataaccagtcggctgtcgcgctggcagtgcgtggtgacaaagccagtttcgaa
gacgtcgtgatcaccggtaaccaggacaccttgttgatcagcgcgaccaacgcggccaat
gtgatccgctcttacttcaagaacagcacaatcgagggcgacgtcgatttcatcttcggc
tcgggtgtcggcgtgttcgacaatgccctcatccgctccgctggcgcgcgcctgggcagc
agcagcggcggctacatcttcgcgcccagtacgcgcccgggcagtccctatggttttctc
gcgatcaatagccgctttgtggctggctcaggctcgcccgacaaccagacctaccttggg
cgtgcctgggacgaaggcgtccgcggcctgtcggcctacgtcaacggcacctcgcccaat
gggcaagtgacagtgcgcgattccaacctgggcagccatattcgcaagaccgcgccgtgg
gatgcgtccaccgccagccgcccgtattgcagcagcaattgcaccaattcggcgaaccgc
ttttatgagtatgggaacagcggcgccggcgctgggaattag

DBGET integrated database retrieval system