KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00603Help
Entry
PXO_00603         CDS       T00763                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00020  Citrate cycle (TCA cycle)
xop00190  Oxidative phosphorylation
xop00650  Butanoate metabolism
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
Module
xop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xop_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PXO_00603 (sdhD)
   00650 Butanoate metabolism
    PXO_00603 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PXO_00603 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACD58889
UniProt: A0A0K0GKN3
Position
2324421..2324807
Genome map
AA seq 128 aa AA seqDB search
MSRYRTPLKNVRGLGAAKTGTEHFVMQRLTAAALVPLSIWFLIFVLSLMGADHAAATAAV
AKPWNAILLVAFLIASFWHAQLGMQVVLEDYVHDSLLALTAQTLVRFVAVVGAIVSVFAV
ARIALGMS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctaccgtaccccgttgaaaaacgtgcgcggcctgggcgccgccaagaccggt
accgaacatttcgtgatgcagcgcctgaccgcggccgcactggtgccgttgtcgatctgg
ttcctgatcttcgtgctgagcctcatgggtgccgatcatgctgcggcgaccgccgcagtg
gctaaaccgtggaatgcgattctgcttgtcgctttcctgattgcctcgttctggcatgcg
cagctgggcatgcaggtggtgctggaagattacgtgcacgactcgttgctcgcactgacg
gcgcagacactcgtgcgtttcgttgccgtggtgggcgccatcgtcagcgtgtttgccgtg
gcgcgtatcgcgctgggcatgagctga

DBGET integrated database retrieval system