KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00658Help
Entry
PXO_00658         CDS       T00763                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xop00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xop00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2267626..2268111
Genome map
AA seq 161 aa AA seqDB search
MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctctccacctttgaattcaccgaccttgagggtcgcacgcagacgatgcgc
gactacgccggcaaggtgctgctggtggtgaatgtggcatccaaatgcggctttacgccg
cagtacgccggcttgcaggccttatggcaacgctatcgcgagcgcgggctggtagtcatc
ggatttccgtgcgatcagtttgggcatcaagagccaggtgatgcggcgcagatccgccaa
ttttgctcgctcgactacgcagtggattttccgctggccgaaaaaatcgaggtcaacggc
agcggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcggctcc
gaggcgatcaagtggaatttcaccaaattcctgatcggccgcgacggccgcgtgctggaa
cgttatgcgcccacgaccaagccggaagcattggccgcagatatcgagcgtgcattggac
gcatga

DBGET integrated database retrieval system