KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00822Help
Entry
PXO_00822         CDS       T00763                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PXO_00822 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PXO_00822 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PXO_00822 (thrC)
Enzymes [BR:xop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PXO_00822 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2406552..2407856)
Genome map
AA seq 434 aa AA seqDB search
MFISTRGGAPAASLSQAIAAGLAPDGGLYVPQTLPPARTLIAGAGLADTATALLQPFFEG
DALAAELSAICAEAFDFPAPLVALGTPGDYALELFHGPTAAFKDFGARFLAACLTRLRRA
EDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGSFDDCQAMVKQALNDAALQTQVPLSSANSISLGRLLPQMSYYAHAALQHHAAWGDVLN
LVVPTGNLGNALAAIIARALGVPLGRIALASNANHVLPDYFAGDAYAPQPSVATLANAMD
VGAPSNFERLRWLYNGDDAALREEFRALSVDDAAIRHTVQQRFARYGEVHCPHTATAVHV
LEQLRAEGAEGGTGDWAVAATAHPAKFEGVVEPLIGRTVEVPPALAALLQRPAQAEALAA
DYAAFRQRLLADAT
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttcatctccacccgtggcggtgcccccgccgcaagcctgagccaggccattgccgcc
gggctggcgcccgatggcggcctctacgtgccacagaccctgccacctgcccgtacgctg
attgcgggcgccggccttgccgacaccgccactgcgctattgcagccatttttcgagggc
gatgcactggcggcagaactctctgccatctgtgccgaggccttcgatttcccggcgcca
ttggtggccttgggtacgccgggcgattacgcgctggagctgtttcatggccccaccgcc
gcattcaaggatttcggtgcgcgtttcctggcggcctgcctgacccgcctgcgccgtgcc
gaagaccgcccgctcaccatcctggtcgccacctccggcgacaccggtgccgccgtggcc
gctgcgttccatcggcagcctggcctgcgtgtggtggtgctctacccggacggccgcgtg
tcgccacgccaggcgcatcagctggggtgtttcggcgacaacattcaggccctgcgtgtg
gccggctcgttcgacgactgccaggcgatggtcaaacaggccttgaacgatgccgcgttg
cagacgcaggtgccgctgagttcggccaacagcatcagcctgggccggctgctgccgcag
atgagttactacgcgcatgccgcgctgcagcaccatgcggcgtggggcgacgtgctcaac
ctggtggtgcccaccggcaacctgggcaacgcgctggcggcgatcatcgcgcgcgcgctc
ggggtgccattaggccgcatcgcgctggcctccaacgccaaccatgtcttgccggactat
ttcgctggcgacgcgtacgcgccgcagcccagcgtggccacgctggccaatgcgatggac
gtgggcgcgccgagcaatttcgagcggctgcgttggctctacaacggcgacgatgccgcc
ttgcgcgaggaattccgtgcgttgtcggtggacgacgcagcgattcgccacaccgtgcag
cagcgtttcgcgcgctatggcgaggtgcattgcccgcataccgccaccgcggtgcatgtg
cttgaacaactgcgtgccgagggcgcggagggcggcaccggcgattgggcggtggcggcc
acggcgcatccggccaagttcgaaggcgtggtggagccattgatcggccggacggtggag
gttccgccggcgctggccgcgctgctgcagcgcccagcgcaagccgaagcactggcggcg
gactatgcggctttccggcagcgtctgcttgcggatgcgacctga

DBGET integrated database retrieval system