KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00822Help
Entry
PXO_00822         CDS       T00763                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00260  Glycine, serine and threonine metabolism
xop00750  Vitamin B6 metabolism
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01230  Biosynthesis of amino acids
Module
xop_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PXO_00822 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PXO_00822 (thrC)
Enzymes [BR:xop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PXO_00822 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACD58967
UniProt: A0A0K0GKF0
Position
complement(2406556..2407860)
Genome map
AA seq 434 aa AA seqDB search
MFISTRGGAPAASLSQAIAAGLAPDGGLYVPQTLPPARTLIAGAGLADTATALLQPFFEG
DALAAELSAICAEAFDFPAPLVALGTPGDYALELFHGPTAAFKDFGARFLAACLTRLRRA
EDRPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGSFDDCQAMVKQALNDAALQTQVPLSSANSISLGRLLPQMSYYAHAALQHHAAWGDVLN
LVVPTGNLGNALAAIIARALGVPLGRIALASNANHVLPDYFAGDAYAPQPSVATLANAMD
VGAPSNFERLRWLYNGDDAALREEFRALSVDDAAIRHTVQQRFARYGEVHCPHTATAVHV
LEQLRAEGAEGGTGDWAVAATAHPAKFEGVVEPLIGRTVEVPPALAALLQRPAQAEALAA
DYAAFRQRLLADAT
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttcatctccacccgtggcggtgcccccgccgcaagcctgagccaggccattgccgcc
gggctggcgcccgatggcggcctctacgtgccacagaccctgccacctgcccgtacgctg
attgcgggcgccggccttgccgacaccgccactgcgctattgcagccatttttcgagggc
gatgcactggcggcagaactctctgccatctgtgccgaggccttcgatttcccggcgcca
ttggtggccttgggtacgccgggcgattacgcgctggagctgtttcatggccccaccgcc
gcattcaaggatttcggtgcgcgtttcctggcggcctgcctgacccgcctgcgccgtgcc
gaagaccgcccgctcaccatcctggtcgccacctccggcgacaccggtgccgccgtggcc
gctgcgttccatcggcagcctggcctgcgtgtggtggtgctctacccggacggccgcgtg
tcgccacgccaggcgcatcagctggggtgtttcggcgacaacattcaggccctgcgtgtg
gccggctcgttcgacgactgccaggcgatggtcaaacaggccttgaacgatgccgcgttg
cagacgcaggtgccgctgagttcggccaacagcatcagcctgggccggctgctgccgcag
atgagttactacgcgcatgccgcgctgcagcaccatgcggcgtggggcgacgtgctcaac
ctggtggtgcccaccggcaacctgggcaacgcgctggcggcgatcatcgcgcgcgcgctc
ggggtgccattaggccgcatcgcgctggcctccaacgccaaccatgtcttgccggactat
ttcgctggcgacgcgtacgcgccgcagcccagcgtggccacgctggccaatgcgatggac
gtgggcgcgccgagcaatttcgagcggctgcgttggctctacaacggcgacgatgccgcc
ttgcgcgaggaattccgtgcgttgtcggtggacgacgcagcgattcgccacaccgtgcag
cagcgtttcgcgcgctatggcgaggtgcattgcccgcataccgccaccgcggtgcatgtg
cttgaacaactgcgtgccgagggcgcggagggcggcaccggcgattgggcggtggcggcc
acggcgcatccggccaagttcgaaggcgtggtggagccattgatcggccggacggtggag
gttccgccggcgctggccgcgctgctgcagcgcccagcgcaagccgaagcactggcggcg
gactatgcggctttccggcagcgtctgcttgcggatgcgacctga

DBGET integrated database retrieval system