KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00847Help
Entry
PXO_00847         CDS       T00763                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PXO_00847
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PXO_00847
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PXO_00847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2522971..2523537
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFADTNPATPEFDSRDGDAIASELKKIGVTFERWHASAPVEPGATPEQVMDAYRA
DIDRISAERGFKTVDVVSIAPDNPKREEMRAKFLDEHFHKEDEVRFFVAGSGLFTLHVDA
KVYEIECVKDDLIAVPDSTLHWFDMGPEPHFVAIRFFTEPDGWVGHFTGTEIAKQFPRYA
PEKPHKAS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactgcgtatctttgccgacaccaatcccgccacacccgaattcgatagccgc
gatggcgatgccattgccagcgaactgaagaagatcggcgtgaccttcgaacgctggcat
gccagcgcgccggtcgaaccgggcgccacgcccgagcaggtcatggacgcctaccgcgcc
gacatcgaccgcatcagcgccgagcgcggcttcaagaccgtggacgtggtgagcatcgcg
ccggacaaccccaagcgcgaggaaatgcgcgccaagtttttggacgagcacttccataag
gaagacgaggtgcggttcttcgtcgccggctctggcctgttcacgctgcacgtggacgca
aaggtttatgagatcgaatgcgtcaaggacgatctgattgccgtgcccgacagcaccttg
cactggttcgacatggggccggaaccgcacttcgtggcgattcgcttcttcaccgagccg
gacggctgggttggacatttcaccggcaccgaaatcgccaaacagttcccccgctacgcc
cccgagaaacctcacaaggccagctga

DBGET integrated database retrieval system