KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00897Help
Entry
PXO_00897         CDS       T00763                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PXO_00897
   00052 Galactose metabolism
    PXO_00897
   00500 Starch and sucrose metabolism
    PXO_00897
   00520 Amino sugar and nucleotide sugar metabolism
    PXO_00897
Enzymes [BR:xop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PXO_00897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2469729..2470547)
Genome map
AA seq 272 aa AA seqDB search
MPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKL
EQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMWNRGDAAL
TQMADVAEASGGSVIAVEDVPQEKTASYGIVSTDAFDGRKGRITAIVEKPKPEVAPSNLA
VVGRYVLSPKIFEFLEATGAGAGGEIQLTDAIAELLKKEQVDAFRFQGRRFDCGAHIGLI
EATVHFALEHEKHGGPAKEILRNALAQADARG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaaagaaatgctgccaatcatcgacaagcccttgattcagtacgccgtcgacgaa
gccatccaggctggttgcgatacgttgatctttgtgaccaaccgctacaaacactccatt
gccgattacttcgacaaggcctacgagctggagcaaaagcttgagcgtgcaggcaagttg
gagcagctggagctagtacgccatgcgttgccggaaggcgttcgcgccatttttgtgacg
caggcagaagcgctcggcctaggccacgcggtgttgtgtgccaaggccgtggtcggtgac
gaaccgttcgcggtgctgctgccggacgatctgatgtggaaccgcggcgatgccgcgctg
acccagatggccgatgttgcagaggcctccggcggcagcgtcattgcggtggaagatgtg
ccgcaggaaaagacggccagctacggcatcgtctctaccgatgcattcgatggccgcaag
ggccgcatcactgcgatcgtcgagaagcccaagccggaagtggcgccgagtaatctggcc
gtagtcggtcggtatgtgctgagcccgaagatcttcgaatttctcgaggctaccggtgca
ggcgcgggcggcgagatccagctgaccgacgcgattgccgagctgctgaagaaagagcag
gtcgatgccttccgtttccaaggtcgccgtttcgattgcggtgcgcatatcggcctgatc
gaagccaccgtgcatttcgcgctcgagcacgaaaagcatggcggcccagcgaaggaaatc
ctgcgcaacgcattggcccaggccgacgcgcgcggctga

DBGET integrated database retrieval system