KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00926Help
Entry
PXO_00926         CDS       T00763                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:xop00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:xop00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2439810..2440568
Genome map
AA seq 252 aa AA seqDB search
MRSILITGAGSGIGAGIATQLATDGHHLIVSDMELAAAERTAHALRQAGGSAEALALDVT
DADSIAQALASASRAPQVLVNNAGLQHVAALDEFPMQQWALLVDVMLTGAARLSRAVLPA
MRAAGYGRIVNIGSIHSLVASPYKSAYVAAKHGLVGLARVIALETADCDITVNTLCPSYV
RTPLMERQIADQARTRGIAEDAVIRDVMLKPMPKGAFIDYDELAGTVAFLMSHAARNITG
QSIAIDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcctgatcaccggcgcgggcagcggcattggcgccggtatcgccacccaa
ttggcgaccgacggccatcacctgatcgtcagcgatatggaactggcggccgccgagcgc
acggcgcatgcgctgcgccaggctggcggctcggccgaggcgctggcgctggatgtcacc
gacgcagacagcatcgcgcaggcactggccagcgcatcccgcgccccgcaagtgctggtg
aacaatgccggcctgcagcacgtggccgcgctggacgagttcccgatgcagcagtgggcg
ctgctggtggatgtgatgcttaccggggccgcacgcctgagtcgcgccgtgctgcccgct
atgcgcgcggccggctatggccgcatcgtcaacatcggcagcatccactcgctggtcgcc
agtccgtacaagagcgcgtatgtcgctgccaaacatggcctggtcggcctggccagggtc
atcgccctggaaaccgccgactgcgacatcaccgtcaacacgctatgccccagctatgtg
cgcacgccgctgatggagcggcagattgccgatcaggcacgcacccgcggcatcgccgaa
gacgcggtgatccgcgatgtgatgctcaaacccatgcccaagggcgccttcatcgactac
gacgagttggccggcacggtggcgtttctgatgtcgcatgccgcgcgcaacatcaccggg
caatccatcgccatcgatggcggctggacggcgcaataa

DBGET integrated database retrieval system