KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01197Help
Entry
PXO_01197         CDS       T00763                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00020  Citrate cycle (TCA cycle)
xop00310  Lysine degradation
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
Module
xop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PXO_01197 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PXO_01197 (sucB)
Enzymes [BR:xop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PXO_01197 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF4813 SAPS
Motif
Other DBs
NCBI-ProteinID: ACD59493
UniProt: A0A0K0GL90
Position
2975149..2976351
Genome map
AA seq 400 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKPGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPADEKKAAAPAAAAPAAAPAAAAAPAPASKSAADS
LPPGARFSAITQGVDPSQVEGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVPMTRVR
KTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKAAANA
LQRFPLVNASIDGDDIIYHGYSDISIAVSTDKGLVTPVLRNVERQSFADVEQGIADYAAK
ARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHTIKERPIAENGQVVIA
PMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaagcccggcgaagcggtcaagcgcgacgagaatctggtcgacctggaa
accgacaaggtcgtgttggaagttccgtcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcacggtcaccagcaaccagattctggcgatcatcgaagaaggcgct
gtggctgcggctgcaccggcggacgagaagaaggccgccgcaccggcagcagcagctcca
gctgccgcgccggctgccgccgctgcaccggcgcctgcgtccaagtctgctgccgattcc
ctgccgccgggtgcgcgtttctctgcgatcacccagggtgtggatccgtcgcaggtcgag
ggcacaggccgtcgtggcgcggtgaccaaggaagacatcgtcaacttcgccaaggccggc
ggcgtgggcaaggcctcgggcgcccgcccggaagagcgcgtgccgatgacccgcgtgcgc
aagacgattgccaagcgcctgatggagtccaagaactccaccgcgatgctgaccaccttc
aacgaggtcaacctggccaaggtatcggccgcacgcaaggaactgcaggacgaattccag
aaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggccgccgccaacgcg
ctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatcatctatcacggc
tacagcgacatctcgatcgcggtgtcgaccgacaagggcctggtcacgccggtgctgcgt
aacgttgagcgccagtcgttcgccgatgtcgaacagggcatcgccgattacgccgccaag
gcacgcgccggcaagctgggcctggatgacctgcagggcggcacctttaccatcaccaat
ggcggcaccttcggctcgctgctgtccaccccgatcatcaacccgccgcagagcgccatc
ctgggcatgcacacgatcaaggaacgcccgatcgccgagaatggccaggtcgtgatcgcc
ccgatgatgtatctggcgctgtcttacgaccaccgcatcatcgatggcaaggattcggtg
cagttcctggtcgacatcaagaaccagctggaaaacccgggccgcatgctgttcggtctg
taa

DBGET integrated database retrieval system