KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01222Help
Entry
PXO_01222         CDS       T00763                                 

Definition
ABC transporter vitamin B12 uptake permease
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PXO_01222
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PXO_01222
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PXO_01222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2956383..2956940)
Genome map
AA seq 185 aa AA seqDB search
MLLNRLLVIVFIGFFAKSAFAAGTPVLDVDYRPLAGKTPINLNLTYGGKVVMVVNTASKC
GYTPQYEGLEALNQRFASRGFTVLGFPSNDFHGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAEATPLYQRLTQATGVAPGWNFHKYLIGRDGRVVAQFPSKIKPDDPSVLAAIEREL
KAPSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaaatcgtctattagttattgtatttattggattttttgcgaaatccgcgttt
gccgccggcactccggtgctggatgtggactaccgcccgctggccggcaagacaccaatc
aacctgaaccttacctacgggggcaaggtcgtcatggtggtcaataccgccagcaagtgt
ggctacaccccccaatacgaaggcctggaagcgctcaatcagcgctttgccagccgcggc
ttcaccgtgctgggcttcccgtcgaacgatttccatggccaggaacccggatctgagaaa
cagatccaggaattctgcacgttgacctatggcgtcaagttcccgatgtttgagaaggtg
catgtgctgggtgcagaggcaacgccgctgtatcagcgcttgacccaagccaccggcgtg
gcgccgggctggaattttcacaagtacctgattggtcgcgatggtcgcgtggttgcgcag
ttccccagcaagatcaagccggacgatccgagcgtcctggccgcaatcgaacgcgagctc
aaggcgccgtcgcgctga

DBGET integrated database retrieval system