KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01270Help
Entry
PXO_01270         CDS       T00763                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PXO_01270 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PXO_01270 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PXO_01270 (trpB)
Enzymes [BR:xop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PXO_01270 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3629147..3630364)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECLVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYVICD
DDGQITETHSISAGLDYPGVGPEHAFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPKDALVLCNLSGRGDKDVHTIAAREGLAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgctggccactttggc
aagtttggcggccggttcgtcgccgaaaccttgattggcccgctgcaggagctgtccgcc
gcctacgatcaagcgcggcaggatccgagcttcatcgccgaatacgacaaggacctcaag
cattacgtcggccgccccagcccgatctaccatgccgaacggctcagccgtgaagtgggt
ggggcgcagatcctgctcaagcgcgaagacctcaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggccctgctggccagccgcatgggcaagacccgcatcatcgccgag
accggcgccggccagcacggcgtggccagcgccactgtcgctgcacgtctgggcctggaa
tgcctggtctacatgggcgccaccgacatcgaacggcagaagatcaacgtctatcgcatg
aagctgctcggtgcgacggtgatcccggtgacctccggttcggccacgctcaaggacgcg
ctcaacgaagcgatgcgcgactgggtcaccaacgtgcgcgacaccttctacatcatcggc
accgtggccggccctgacccgtatccgcgcatggtgcgtgacttcaacgcgattgtcggc
cgcgaggcgcgcgcgcagatgctggaagactacggccgtctgccggatgcgatcagcgcc
tgcgtcggtggcggtagcaatgcgatcggcctgttccatgccttcctcaacgacccgggc
gtcaagatctatggcgccgaggcggccggcgacggcatcgctaccggccgccatgcggca
tcgatcgccgcagggcgccccggtgtgttgcatggcaatcgcacctatgtgatttgcgac
gacgatggccagatcaccgaaacccattcgatctctgccggcctggattaccccggcgtg
ggtccggagcatgcgtttctgtccgacagcggccgcgcggtgtatcagggcattaccgac
gacgaggcgatggccgcgttccatctgcttgcgcataccgaaggcatcctggccgcactt
gaatccagccatgcggtggcgcagtcgatcaagctcgcgcgcgagctgccgaaagacgcg
ttggtgttgtgcaacctgtctgggcgtggcgacaaggatgtgcataccatcgcggcgcgc
gaggggctcgcgctgtag

DBGET integrated database retrieval system