KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01272Help
Entry
PXO_01272         CDS       T00763                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00260  Glycine, serine and threonine metabolism
xop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01130  Biosynthesis of antibiotics
xop01230  Biosynthesis of amino acids
Module
xop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PXO_01272 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PXO_01272 (trpA)
Enzymes [BR:xop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PXO_01272 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB TMP-TENI DUF561
Motif
Other DBs
NCBI-ProteinID: ACD60109
UniProt: B2SVN5
Position
complement(3626370..3627176)
Genome map
AA seq 268 aa AA seqDB search
MRRIDFRFAELRANGRKALIPFITAGDPSLEATVPVMHALVRAGADVIELGVPFSDPMAD
GPTIQRSSERALGRGAGLAYVLEAVHEFRREDAATPVVLMGYLNPIEIHGTRRFAEAAVA
AGVDGLLLVDLPPEEADETRAIFTEVGLALIALASPTTSEQRLDMLCSTAQGYLYYVSFA
GVTGASNLLDTYAASDRLRQLRQRAGAPVVAGFGIKDAASAAAMAVDADGVVVGSALVAA
LAEADDVRSARERAEAFLAPLRQALDQA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtatcgatttccgcttcgccgagctgcgtgccaacggtcgcaaggcactgatc
cccttcatcaccgccggcgacccatcgctggaagccactgtgcccgtcatgcacgcgctg
gtgcgcgccggtgccgatgtcatcgagctcggtgtgccgttctccgacccgatggcggac
ggccccaccatccagcgcagctccgagcgcgcgctgggacgcggtgccggccttgcgtac
gttttggaagcggtgcacgagttccgccgcgaagacgccgccacgccggtggtgttgatg
ggctacctcaacccgatcgagatccatggcacgcggcgcttcgccgaagcggctgtcgcc
gccggcgtggacggcctgctgctggtcgatctgccgccggaggaagccgatgaaacgcgc
gccatcttcaccgaggtcgggctggcgctgatcgcactggcatcgcccaccaccagtgag
cagcgcctggacatgctgtgcagcactgcgcagggctatctgtattacgtcagttttgct
ggcgtcaccggcgcctccaacctgctcgacacctacgccgccagcgaccgcctgcgccaa
ctgcgtcagcgtgccggcgcgccggtggtggccggcttcggcatcaaggacgccgccagc
gctgccgccatggcggtggatgcggacggcgtggtggtcggcagtgctctggttgccgcc
ctggccgaagccgacgacgtccgcagcgctcgcgaacgcgcagaggccttcctggccccc
ttgcgccaagccctcgaccaagcgtag

DBGET integrated database retrieval system