KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01626Help
Entry
PXO_01626         CDS       T00763                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PXO_01626
Enzymes [BR:xop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PXO_01626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3275960..3277801
Genome map
AA seq 613 aa AA seqDB search
MLRTTLAPLVLALAFALPVTAAAADTERWPDFGTQGTQFVRDGKPYQLLSGAIHFQRIPR
AYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNNDVAAFVQEAAAQGLNVILRP
GPYACAEWEAGGYPAWLFGQGNIRVRSRDPRFLAASQAYLDAVAKQVQPLLNHNGGPIIA
VQVENEYGSYADDHAYMADNRAMYVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPG
EAKSAFDKLIAFRPDQPRMVGEYWAGWFDHWGKPHAATDATQQAEEFEWILRQGHSANLY
MFIGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAIVDEAGRPTAKFALMRDAIARVTGV
QPPALPAPIATTTLPDTPLRESASLWDNLPAPIAIDTPQPMEHFGQDYGYILYRTTVTGP
RKGPLYLGDVRDVAHVYLDQTPVGSVERRLQQVSTAVDIPAGHHTLDVLVENSGRINYGP
RMADGRAGLVDPVLLGNQQVTGWQAFPLPMRAPDSIRGWTRKAVQGPAFHRGTVRIGTPA
DTYLDMRAFGKGFAWANGVNLGRHWNIGPQTALYFPAPFQRKGDNTVVVFDLDDVATPSV
RGLKQQVWRKPKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaccacccttgcaccgctcgttctggcgctcgccttcgcgctgcctgtcact
gctgcagccgcagacaccgagcgctggccggacttcggcacgcaaggcacacagttcgtg
cgcgacggcaagccgtatcaattgctttccggcgccatccatttccagcgcattccgcgc
gcctactggaaagaccgcctgcaaaaagcgcgtgcgctgggcttgaacacggtggaaacc
tacgtgttctggaatctggtggaaccgcagcaaggccagttcgatttttccggcaacaac
gacgtggccgcgttcgtgcaagaagctgccgcgcaggggttgaatgtcatcctgcggccc
ggcccttacgcctgcgcagagtgggaagccggcgggtatccggcctggttgttcggccag
ggcaacattcgcgtgcgcagccgcgacccacgctttcttgctgccagccaggcctatctg
gatgcggtggccaaacaggtgcagccgctgctcaaccacaacggcgggccgatcatcgcc
gtgcaggtcgagaacgaatacggctcttacgcagacgaccacgcctacatggccgacaac
cgcgccatgtacgtcaaggccggcttcgacaaggccttgctgttcacctccgatggcgcc
gacatgctcgccaacggcaccttgcccgacaccttggcggtggtgaacttcgcacccggc
gaagccaagagcgcattcgacaagctgatcgcgttccgccccgatcaaccgcgcatggtc
ggcgaatactgggcgggctggttcgaccattggggcaagccgcacgcggccaccgatgcc
acacaacaggccgaggagttcgagtggatcctgcgccagggccactccgccaatctctac
atgttcatcggcggcaccagttttggcttcatgaacggcgccaatttccagaacaatccc
agcgatcattacgcaccgcagaccaccagctacgactacgacgccattgtcgacgaagcc
gggcgccccacagccaagttcgcgttgatgcgcgatgccatcgcccgcgtcaccggtgtg
cagccgcctgcattgccggcaccgatcgcgaccaccacgctgccagacacgccgttgcgc
gaatcggcctcgctgtgggacaacctgcccgcaccgatcgccatcgacaccccgcagccg
atggaacacttcggccaggattacggctacatcctttatcgcaccaccgtcaccggcccg
cgcaagggcccgctgtatctgggcgacgtgcgcgatgtggcgcacgtgtatctggatcag
acgccggtcggcagcgtcgaacgccggctgcagcaggtctccaccgctgtggatattccg
gccggccaccacacgctggatgtgctggtggaaaacagcggccgcatcaattacggcccg
cgcatggccgacggccgcgccggcctggtcgacccggtgctgctgggcaaccagcaagtc
accggctggcaggccttcccgctgccgatgcgcgcacccgacagcatccgcggctggacc
cgcaaggcagtgcaaggcccggcgttccaccgcggcaccgtgcgcatcggcacacccgcc
gacacctacctggacatgcgcgccttcggcaagggcttcgcctgggccaacggcgtcaac
ctcggccgccactggaacatcggcccacaaaccgcgctgtatttcccagcgccgttccag
cgcaagggtgacaacacggtggtggtcttcgacctagacgatgtcgccacacccagcgtg
cgcggcctgaagcagcaggtgtggcgcaagccgaaagagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system