KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01709Help
Entry
PXO_01709         CDS       T00763                                 

Definition
fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PXO_01709
   01212 Fatty acid metabolism
    PXO_01709
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PXO_01709
   00650 Butanoate metabolism
    PXO_01709
  Lipid metabolism
   00071 Fatty acid degradation
    PXO_01709
   01040 Biosynthesis of unsaturated fatty acids
    PXO_01709
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PXO_01709
   00310 Lysine degradation
    PXO_01709
   00380 Tryptophan metabolism
    PXO_01709
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PXO_01709
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PXO_01709
   00281 Geraniol degradation
    PXO_01709
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PXO_01709
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PXO_01709
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PXO_01709
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PXO_01709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3174817..3176898
Genome map
AA seq 693 aa AA seqDB search
MLPGFDGLRFSHWQAELREDGVVVLSLDRQDAPVNAFSQEVLLELGALVERLALEPPKGV
VLRSGKANGFIAGADLKEFQQFDHKGTVNDAIHRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLSGRTVS
AKAARAMGLVDKVAAPAVLVDAAAALALAGTTRPFQQRATAWATNTLLARKILAPQMRKQ
VARKARKEHYPAPYALITVWERAGGSGIQARLAAERKAVVKLASTPTARNLIRIFFLTER
LKALGGKDAAGAAATPIRHVHVIGAGVMGGDIAAWAAYKGFDVTLQDREQRFIETALTRG
GELFAKRVKDDAKRPAVAARLRGDLAGAGVTQADLVIEAIIENPQAKRDLYQSIEPQLKP
DALLTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLAAF
CKALDKFPVPVAGTPGFLVNRVLFPYLLEAATAYAEGIPGPVLDKTAVKFGMPMGPIELI
DTVGLDVAAGVGAELAPFLHLPIPAALITVEAGKRGKKDGQGLYTWENGRAVKPEVASGY
IAPADLEDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQHIRSVGAD
ALLERLQALHARYGERFAPRPGWDSPVLREAVV
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggccgagctgcgcgaggac
ggcgtggtcgtgctcagcctcgatcgccaggacgcaccggtcaacgcattttcccaggag
gtgctgctggagttgggcgcactggtcgagcgcctggcactggagccgcccaagggcgtg
gtgctgcgctcgggcaaagccaacggtttcatcgccggtgccgatctgaaagaatttcag
caattcgaccacaagggcacggtcaacgatgcgattcatcgcgggcagcaggtctttcag
aagctggccgaactgccctgcccgaccgttgcggcgattcatggcttctgcatgggcggc
ggcaccgaaatcgcgctggcatgccgctaccgcgtggcctccgacgatggcagtacgcgc
atcgggttgccggaaaccaagctcggcatcttccccggctggggcggcagcgcccgcttg
ccgcgcctgatcggtgcgccggcggcgatggacctgatgctcagcggccgcaccgtgtcg
gccaaggctgcgcgcgcaatgggtctggtcgacaaggtcgccgcacctgcggtgctggtc
gatgcggctgcggcactggcgctcgcgggtacgacgcgtccgttccagcagcgcgccact
gcgtgggccaccaacaccttgctggcgcgcaaaatactggcgccgcagatgcgcaaacaa
gtggcccgcaaggcgcgcaaggagcattaccctgcgccatacgcgttgatcacggtgtgg
gagcgggctggcggcagcggcatccaggcccgcctggcggccgagcgcaaggcagtggtc
aagctcgccagcacgccgaccgcacgcaacctgatccgcatcttcttcctgaccgagcgt
ttgaaggcgctgggcggcaaggatgcagccggcgcggcagcgacgccgatccgccatgtg
cacgtcatcggcgctggcgtgatgggcggcgacatcgcggcgtgggcggcctacaagggc
ttcgacgtcacattgcaggaccgcgagcagcgttttatcgagacggcgctgacgcgcggc
ggcgaactgttcgccaagcgcgtcaaagacgacgccaagcggccggccgtggccgcgcgt
ctgcgcggtgacctggccggtgcgggtgtgacgcaggccgatctggtgatcgaggcgatc
atcgaaaacccgcaggccaagcgcgatctgtatcaatcgatcgagccgcagctcaagccg
gatgcattgctgaccaccaatacatcttcgattccgctgaccgaactgcgtggccacatc
cagcgcccggcgcagttcgccggcctgcactatttcaacccggtggcgatgatgccgctg
gtggaaatcgtgcagcacgatggcctggatcccgccaacgtggcgcgcctggctgcattc
tgcaaggcactggacaagttcccggtgccggtggccggcacgccggggttcctggtcaac
cgggtgctgttcccgtacctgcttgaagcggccaccgcgtatgcggaaggcatacccggc
ccggtgctggacaagacggcggtgaaattcggcatgccgatggggccgatcgagttgatc
gacaccgtgggtctggacgtcgccgccggcgtgggcgcggagttggcgccgttcctgcac
ctaccgattccggcagcgctgatcacggtggaagccggcaagcgcggcaagaaggacggc
cagggcttgtacacgtgggagaatgggcgtgcggtcaaaccggaggttgccagtggctac
atcgcaccggcagatctggaagaccggctgattctgccgctgctcaacgaagcggtggcg
tgtctgcacgacggcgtggtggccgacgcagacctgctcgatgccggcgtcatcttcggc
accggctttgcgcccttccgcggtggcccgatccagcacatccgcagcgtcggcgcagat
gcgctgctggaacgtttgcaggcgctgcacgcacgttatggcgaacgtttcgcaccgcgc
ccgggttgggactcgccggtgttgcgggaggcggtggtgtaa

DBGET integrated database retrieval system