KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01717Help
Entry
PXO_01717         CDS       T00763                                 

Gene name
rnc
Definition
ribonuclease III
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3167421..3168101)
Genome map
AA seq 226 aa AA seqDB search
MSNRIFQRGDPIGHAFADPDLLAQALRHRSAGTPHNERLEFLGDGIVNLLVAEALYQRWP
KADEGALTRARAELVREGALAVIGRTLNLGERLTLGPGEWKSGGHRRDSILADAVEAIVA
AIYLDCGFERCRAVVLPWFEASLAALPVGKAEKDPKTRLQEWLQARQLPLPNYALISESG
DEHAKQFHVACILEQPVARAEGQGTSRRLAEQQAATLVIAQLDSRM
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaatagaatcttccaacgcggtgatccgatcgggcatgcatttgccgatccggat
ctgctcgcccaggcgctgcggcatcgcagcgccgggacgccgcacaacgagcggctggaa
tttctcggcgacggcatcgtcaatctgctggtcgccgaggcgctgtatcaacgttggccc
aaggccgatgaaggcgcattgacccgcgcgcgggccgaactcgtacgcgaaggcgcgctg
gcagtgatcggacgtacgttgaacctcggcgagcgcctcacgctgggtccaggtgagtgg
aagtccggtggtcatcggcgcgattcgatcctggccgatgctgtcgaagcgattgtcgcg
gccatctacctggactgcggtttcgagcgttgccgtgcggtggtgctgccgtggttcgaa
gcctcgctggcggcattgccggttggcaaggcagaaaaagatcccaagacccggctgcag
gaatggctgcaggcgcgccagctgccgctgcccaattacgctctgatcagtgagagcggc
gatgagcatgccaagcagttccatgtcgcctgcattctggagcagcccgtcgcccgcgcc
gagggccagggcacctcgcgtcgtcttgccgagcaacaggcggcgactcttgtcatcgca
caactggattcaagaatgtga

DBGET integrated database retrieval system