KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01728Help
Entry
PXO_01728         CDS       T00763                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xop00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:xop00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3156647..3157732)
Genome map
AA seq 361 aa AA seqDB search
MRDLTLPRASATMLRCATKAPGPGVPNMLLIGVAGTKLSAQERDWLQHDAVAGVVLFKRN
FGSRSQVAELSAAIRAASPRPVLICVDQEGGRVQRFREGFSALAPLQSFGAQYAQAPEAA
LAAARAHAQLMASEVRASGVDLSFAPVVDLGRGNRAIGDRAFSDDPQIVATFTRAYVQAL
HGAGMAATLKHFPGHGTVLEDTHVDHASDPRPLEALQAEDLVPFVAGIEAGADAVMMAHV
VYPQVAPEPAGYSQRWIEQILRGQMGFRGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCD
VVLVCHPELVAESLQAVQGRRLNTAALIGLIGRGALGWDGLLAGTDASFTTPHSAHFGTT
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatctgacgctgccacgcgcatctgcgacaatgctgcgctgcgccaccaaggcg
cctggcccgggagtccccaacatgcttctgatcggcgttgccggtaccaaactcagcgca
caggaacgcgactggctacagcacgatgcggttgccggcgtggtgctgttcaagcgtaac
ttcggctcgcgcagccaggtggccgagctgtcggcggcgatccgcgcggcatcgccgcgc
ccggtgctgatctgcgtggaccaggaaggcggacgcgtgcagcggtttcgcgaaggattc
agcgcgctggcgccgttgcaaagtttcggggcgcagtacgcgcaggcccctgaggctgca
ttggctgccgcacgcgcacatgcgcagctgatggccagcgaggtccgcgccagtggtgtg
gacctgagcttcgcgccggtggtggatctaggccgcggcaatcgcgccatcggcgatcgc
gccttcagcgacgacccgcagatcgtggccaccttcacccgcgcttatgtgcaggcgctg
cacggcgccggcatggccgccacgctcaaacattttcccggccacggcaccgtgctggaa
gacacccatgtcgaccacgccagcgacccgcggccgctggaggcgttgcaggccgaagat
ctggtgccgttcgtggccggcatcgaggccggcgccgacgcggtgatgatggcgcacgtg
gtttacccccaggtggccccggaaccggctgggtattcgcagcgctggatcgaacagatc
ctgcgcggccagatgggcttccgcggcgtggtcttttccgacgatatcggcatggccgcc
tcgttcagtgccggcggcgtggcaggccgggtgcatgcgcatctggatgccggctgcgat
gtggtgttggtctgccacccggaactggtcgccgaatcgctgcaggccgtgcagggccgt
cgcctcaataccgccgcattgatcggcctgatcggccgcggcgcattgggctgggatggc
ctgctcgccggcaccgacgcctcattcaccactcctcattctgcccatttcggaacaact
gcctga

DBGET integrated database retrieval system