KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01780Help
Entry
PXO_01780         CDS       T00763                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PXO_01780
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PXO_01780
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PXO_01780
Lipid biosynthesis proteins [BR:xop01004]
 Desaturase
  First
   PXO_01780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3105619..3106548
Genome map
AA seq 309 aa AA seqDB search
MAARIGSLRRWVDSQTDEPLDEARADRIDWLRALPFIALHLACLAVFWVGASWFAVGMAV
ALYALRMFTLTGFYHRYFSHRAFKTSRVLQFVFAAIGATCVQRGPLWWAAHHRNHHRHTD
TGRDPHSPAQHGFWWSHTGWFLTPRNFRTDWDVIPDLRRFAELRFLDRFDIVMPALLALG
LYLLGDWLAVAAPALKTNGAQLLAWGFAISTVALFHATFTINSLAHRFGSQRFDTRDDSR
NNWLLALLTFGEGWHNNHHFFPGSVRQGLRWWEYDVTWYGLTAMSWVGLVWDLKPMPKRL
TQRAERVRQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcgcgcatcggcagcctgcgtcgctgggtggattcgcagaccgacgagcccctg
gacgaagcccgcgccgatcgcatcgactggctgcgtgcactgcccttcattgcactgcat
ctggcttgcttggcggtgttctgggtaggcgcgtcgtggtttgcggtgggcatggcggtg
gcgctgtacgcattgcgcatgttcacgctcaccgggttttatcaccgctacttctcgcac
cgtgcgttcaagacctcacgggtgctgcaattcgtcttcgccgccatcggtgccacctgc
gtgcagcgcggaccgctgtggtgggcggcgcatcatcgcaaccatcatcggcataccgat
accggccgcgacccgcattcgccggcgcagcacggcttctggtggagccacaccggctgg
ttcctgaccccacgcaatttccgcaccgattgggacgtgattcccgacctgcgccgcttt
gccgaactgcgctttctggaccgcttcgacatcgtgatgccggcgctgctggcgctcggc
ctctacctgctcggcgactggctggcggttgcggcgcccgcgctgaagaccaacggtgcg
caattgctggcgtggggctttgcgatctccaccgtggcgctgttccatgccaccttcacc
atcaactccctggcgcatcgcttcggcagccagcgtttcgacacgcgcgacgatagccgc
aacaactggctgctggcattgcttacctttggcgaaggctggcacaacaaccaccacttc
ttccccggctccgtgcgccagggcttgcggtggtgggaatacgatgtgacctggtacggg
cttaccgcgatgtcgtgggtggggctggtgtgggacctcaagccgatgccgaagcggctc
actcagcgggccgaacgggtgaggcaatga

DBGET integrated database retrieval system