KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02261Help
Entry
PXO_02261         CDS       T00763                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_02261
   00052 Galactose metabolism
    PXO_02261
Enzymes [BR:xop01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PXO_02261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4026048..4027088)
Genome map
AA seq 346 aa AA seqDB search
MFGQLTDGVEIHALTLRSEAGLEAEVLTYGGILHTLQLTSARGVLPLVLNLPDLPAYAAD
GDSLNILVGRFGNRIAGARYTLDGVTHVLAANEGRNQLHGGLRGFGRRVWSVLEQAPDHV
LLGYDSPDGEEGYPGNLQVRARLQLHGLSLQLDFEAHCDAATALNLTHHPYFNLSGDPHL
RAAVQVLRVPADRYLPVDAESIPTGEIASVAGTPFDFRQPAALADNTDPAHPQVVLGKGY
DQCLVLAADADCVAELYSPHSGVALRIRSDAPAVQLYEGQHLDAHHPGLGRGVCLEPQDY
PDAPNHANFPSTILRPGETYRRRISYHFASAGQDQPWDMVCAALEG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgggcagttgacagacggtgtcgagattcatgcgctcacgctacgcagcgaggcc
ggtctcgaggcggaggtgctcacctatggcggcatcctgcatacgctgcagttgaccagc
gcacggggcgtgctgcccctggtgctgaacttgccggatctgcccgcctacgccgccgac
ggcgacagtctcaatatcctggtgggccgcttcggcaaccgcatcgccggtgcgcgctac
acgctggatggcgttacccacgtgctggcggccaatgaagggcgcaaccagttgcatggc
ggtctgcgcggttttgggcgacgcgtgtggagtgtgctggagcaggcgccggatcacgta
ctgctgggctacgactcgcccgatggcgaagaaggttaccccggcaatctgcaagtgcgt
gcgcgcctgcagcttcacgggttgagcctgcagctggatttcgaagcgcactgcgacgcc
gctacggcgttgaaccttacccatcatccatatttcaatctgtccggcgacccgcacctg
cgtgccgcagtgcaagtgctgcgcgtgccggccgatcgctacctgccggtggatgccgaa
tcgatcccgaccggcgagatcgcgtcggtggccggcaccccattcgatttccgccagcct
gccgcgctcgccgataacaccgatccggcccatccgcaggtggttctcggcaagggctac
gatcagtgcttggtgctggccgccgacgcggactgcgtagccgagttgtattcgccgcac
agtggcgtggcgctacgcatccgcagcgatgcccccgcggtgcagttgtacgaaggccaa
catctggacgcacatcatccgggactggggcgcggcgtatgcctggagccgcaggactac
ccggacgcgcccaatcacgccaacttcccttcgacgatcttgcggcctggggaaacctac
cgccgccgcatcagctaccacttcgccagtgcggggcaggaccagccctgggacatggtg
tgcgccgcactggaggggtga

DBGET integrated database retrieval system