KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02367Help
Entry
PXO_02367         CDS       T00763                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00230  Purine metabolism
xop01100  Metabolic pathways
Module
xop_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PXO_02367
Enzymes [BR:xop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PXO_02367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase AAA_29
Motif
Other DBs
NCBI-ProteinID: ACD60658
UniProt: A0A0K0GP56
Position
complement(4215337..4215948)
Genome map
AA seq 203 aa AA seqDB search
MRGTLYIVAAPSGAGKSSIVNATLARDPKIALSISFTSRAPRPGERHSEHYHFVSAEEFQ
GMIAAGDFFEYALVHGDWKGTARQSVEPQLAAGHDVLLEIDWQGARQVRQKVPDAVSVFI
LPPSRQALDERMRKRGQDSEDVMAQRLAAAREEMLHFEEFDYVIINETFDTAVSEMCAIF
TASRLRRQAQQQRHAGLIQALLD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcacactctatatcgttgcggccccttcgggcgccggcaagagcagcatcgtc
aacgccaccctggcacgcgacccgaagatcgccttgtcgatctcgttcacctcgcgcgcg
ccgcggccgggcgagcggcattccgagcactaccacttcgtctctgccgaggagtttcag
ggcatgatcgcggcgggtgatttcttcgaatacgcgctggtgcatggggactggaagggc
accgcgcggcagtcggtcgaaccgcagctggctgccggtcacgacgtcctgctggagatc
gactggcagggcgcgcgtcaggtgcgccagaaggtgcccgatgcggtcagcgtgttcatc
ctgccgccctcgcgccaggcgctggacgagcgcatgcgcaagcgcgggcaggacagcgag
gatgtgatggcgcagcgcctggccgccgcccgcgaggaaatgctgcatttcgaagagttc
gattacgtgatcatcaacgaaaccttcgacaccgcggtgtcggagatgtgcgccatcttc
accgccagccggctgcggcggcaggcgcaacagcagcggcatgccgggttgatccaggcg
ttgctggactga

DBGET integrated database retrieval system