KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02589Help
Entry
PXO_02589         CDS       T00763                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PXO_02589
   01230 Biosynthesis of amino acids
    PXO_02589
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_02589
   00030 Pentose phosphate pathway
    PXO_02589
   00051 Fructose and mannose metabolism
    PXO_02589
   00052 Galactose metabolism
    PXO_02589
  Energy metabolism
   00680 Methane metabolism
    PXO_02589
Enzymes [BR:xop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PXO_02589
Protein phosphatases and associated proteins [BR:xop01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PXO_02589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4435192..4436448
Genome map
AA seq 418 aa AA seqDB search
MTTGNVLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREDLIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAYDQTAFLAKVKQVVDKVGWCVV
VASEGIQNAHGKFVADAGGAADSFGHAQLGGVAAFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDTPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAPLAYGSDGLPTYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggcaacgtgttgtatgcccaatccggcggcgttaccgccgtcatcaacgcc
accgccgccggtgtcatcgccgaagcgcgcgcacgcaagatcaaggtactggctgcacgc
aacggcatcctgggcgccttgcgcgaggacttgatcgacacatccaaagaatccgccgca
gccattgccgcattggcgcagacacccggcggcgcgttcggctcgtgccgctacaagctc
aaatcgttggaagaggacagcgccaagtacgagcgcctgctcgatgtgctgcgcgcgcac
gatgtgcgctggtttctctacaacggcggcaatgattcggccgacaccgcgtggaaggtc
tcgcaactcgcaaaagcctatggctacccactgcactgcatcggcgtacccaagaccatc
gataacgacctggcggtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtccgcgaggccgccttggacgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaagccatgggccgccacgccggctggctggccgcagccgcaggcctt
gccgggcagggccccgacgacgcaccgcagatcatcctgctgcccgaacgcgcctacgac
cagaccgcgtttctggcaaaggtaaagcaggtagtggacaaagtcggctggtgcgtcgtg
gtagccagcgaaggcatccagaacgcgcacggcaagttcgtcgccgatgccggcggcgcg
gcggattccttcggccacgcgcagctcggcggcgtggccgcgttcctggccgcacaggtc
aagcaggaactcggctacaaggtgcactggaccttgcccgattacctgcaacgctccgca
cgccacctcgcatcgaagaccgactgggaacaggcccaagccgtcggcaaggccgccgtg
cagtacgccctcaagggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacacc
ccctaccgctggaagatcgtacccgcgcccctgcacaaggtggccaaccacgaaaagaaa
atgccgcccagtttcctgcgcaaggacggcttcggcatcaccgagcgcgcccgccgctac
ttcgccccgttgatcaaaggcgaagcgccgctggcctacggcagcgatggtttgccgacg
tatgtgacgttgaagaatgtggcggtggcgaagaagttgccggcgtgggaggggtga

DBGET integrated database retrieval system