KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02658Help
Entry
PXO_02658         CDS       T00763                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PXO_02658
   00240 Pyrimidine metabolism
    PXO_02658
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PXO_02658
   03430 Mismatch repair
    PXO_02658
   03440 Homologous recombination
    PXO_02658
Enzymes [BR:xop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PXO_02658
DNA replication proteins [BR:xop03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PXO_02658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4585556..4585981
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANNANLSTLILARDAEQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttctacctgatcgccaagccgcgcttcctcaacgaaccgctgcgg
ctggtgtgcgagctggcgcgcaaggccaacaacgccaacctgtcgacgctgatcctggcc
cgcgatgcggagcaggccgaggcgttggacgacctgctgtgggcgttcgacgacgaagcc
tacgtcccgcaccagatcgccggcaccgacgaggaagacgagctggccccggtgctgatc
gccgcccccgagttcgccgccccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtcgtgcccgccgacccggccgcccgcgaa
ccgctgcgcgagcgttggaaacagtacaaggccctgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system