KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02922Help
Entry
PXO_02922         CDS       T00763                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_02922
   00030 Pentose phosphate pathway
    PXO_02922
   00051 Fructose and mannose metabolism
    PXO_02922
   00052 Galactose metabolism
    PXO_02922
   00500 Starch and sucrose metabolism
    PXO_02922
   00520 Amino sugar and nucleotide sugar metabolism
    PXO_02922
  Nucleotide metabolism
   00230 Purine metabolism
    PXO_02922
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PXO_02922
Enzymes [BR:xop01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PXO_02922
    5.4.2.8  phosphomannomutase
     PXO_02922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4878050..4880398)
Genome map
AA seq 782 aa AA seqDB search
MSKANERRQSMSSVRMSGLVLAGILLLLAAWFGWNSYAQWRKDAVAQNLEQARDRAVQDV
GQAMATQASQLDAVLKQPPVVAALAGGDALAAASAIRERFKGAEDVQVLPGDLAAAYANP
KDFGYARLSLLESAQVADHAQVHVIRDAKQVRLGIAAAVRLGAQPAVAYVRLPLLRLTAP
LDAIAVPGSAYLALRQGSYNVAQQGDAGLSDAAETLAKPLGTSGLRVAAAVPQGNSGTLG
PGAVGCAIVAALLLIIAVLLVLASRGQVALPRRRVAGQSSADEPTLSQSLQQDASIASEA
RALDVDASPTVPPVLVPAVQIATEMFRAYDIRGVVGKDLNPGVAALIGQAIGSVMQAQGL
RHVVVGRDGRLSGPELTNGLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGS
HNPPDYNGFKIVIGGETLSGTAIAELHQRINEGRLHTAATPGELEQRDISDAYIQRIADD
VQLDRPIKVVVDAGNGVAGEIAPRLLEAIGAKVVPLYCDIDGTFPNHHPDPSEPHNLDDL
VRMVQRFDADIGVAFDGDADRLGVVTKEGTVVFPDRLLMLFAADVLQRNPGALVIYDVKC
TGKLSDYVLRNGGSPLMWKTGHSLIKSKMRETDAELAGEMSGHFFFKERWYGFDDGIYAA
ARLLEILAQSEQTPSEVLDALPESVSTPEIKVPVEGDAHALVARFVERAQTGGESPFESA
RLSTIDGLRADFVDGWGLIRASNTTPILVLRFEADSEAALQRIRTLFREELQALVPAHPL
AF
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgaacgagcgcaggcagtcgatgtccagcgtgcgtatgagtggtctggta
ttggcgggcatattgctgttgctggccgcttggttcggctggaacagttatgcgcaatgg
cgcaaagacgcggtggcgcagaaccttgagcaggcgcgcgatcgcgcagtgcaggacgtg
ggccaggcgatggccacgcaggccagccagctcgacgccgtgctcaagcagccgccggtg
gtcgctgccctggccggtggcgacgcgctggcggccgcatcggccatccgcgagcgcttc
aagggcgccgaggatgtgcaggtgttgcctggcgacctcgccgcggcctatgccaatccc
aaggatttcggttatgcgcgtctgagcctgctcgaatcggcgcaggtggccgatcatgca
caggtccacgtgatacgcgacgccaaacaggtgcgcttgggtattgcggcggcagtgcgc
ctgggtgcgcagccggcggtggcgtacgtgcggttgccgctgctgcgcctgaccgcccca
ctggatgcgatcgcagtgcccggcagcgcgtatctggccttgcgccagggcagctacaac
gtggctcaacagggcgatgccggcttgtccgatgcggccgaaacgctggccaaaccgctc
ggcaccagcggcctacgcgtggctgcagcggtgccgcaaggcaatagcggcacgttgggt
ccgggcgccgttggttgcgccattgtggcggcgttgctgctgatcattgcagtgctgctg
gtgctggccagtcgggggcaggtggccttgccacgccgtcgggttgccggccaatccagc
gccgatgaacccaccctcagtcagagcctgcagcaggacgccagcattgccagcgaagcg
cgcgcgctggacgtcgacgcctcgcccacagtgccgccggtgctggtgccggcggtgcag
atcgccaccgagatgttccgcgcctacgacatccgtggtgtggtcggcaaagacctcaac
cccggcgttgccgccttgatcggccaggccatcggcagcgtgatgcaggcgcagggcctg
cgccatgtggtggtcggccgcgacggccggctgtccggaccggagttgaccaatggcctg
atcgaaggcctgcgccgcgccggctgcaatgtcaccgacatcggcttggcgccgacgccg
gtggtgtacttcggcgcgtacgagctgcgtgccggcagctgcgtggcggtgaccggcagc
cacaatccgccggactacaacggcttcaagatcgtgatcggcggcgagaccttgtccggc
accgccattgccgaattgcaccagcgcatcaacgaaggccgcctgcataccgctgccacg
cccggcgaactggagcagcgcgacatcagcgatgcctacatccagcgcattgccgacgac
gtgcagcttgatcgcccgatcaaggtggtggtggacgccggcaacggcgtcgccggtgag
atcgcgccgcgccttctggaagcgatcggcgccaaagtggttccgttgtattgcgatatc
gacggcacttttcccaatcatcaccccgacccgagcgagccgcacaacctcgacgatctg
gtgaggatggtgcagcgtttcgatgcggatatcggcgtggcgttcgatggcgacgccgat
cgcctgggcgtggtcaccaaggaaggcacggtggtgttccccgaccgcctgctgatgctg
ttcgccgccgatgtgctgcagcgcaatcccggcgcgttggtcatctacgacgtgaaatgc
accggcaagctgtccgactacgtgttgcgtaatggcggcagcccgttgatgtggaagacc
gggcattcgctgatcaaatccaagatgcgcgagaccgacgccgaactggctggcgagatg
agcgggcacttcttcttcaaggagcgctggtacggcttcgacgacggcatctacgccgct
gcacgcttgctggaaattctcgcccagagcgagcagaccccgtccgaggtattggacgcc
ttgcccgaaagcgtctccacgccggagatcaaggtgccggtggagggcgatgcgcatgcg
ctggtcgcgcgttttgtcgagcgtgcgcagaccggcggagaatcgccgttcgagtcggca
cggctgtcgaccatcgatggcttgagggcggatttcgtcgatggctggggcctgatacgc
gcttccaacaccacgccgatcctggtgctgcggttcgaagccgacagcgaggctgcattg
cagcggattcgcacgctgttccgcgaggaactgcaggcgttggtgcctgcgcatcccttg
gcgttctga

DBGET integrated database retrieval system