KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03174Help
Entry
PXO_03174         CDS       T00763                                 

Gene name
xanA
Definition
phosphohexose mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_03174 (xanA)
   00030 Pentose phosphate pathway
    PXO_03174 (xanA)
   00051 Fructose and mannose metabolism
    PXO_03174 (xanA)
   00052 Galactose metabolism
    PXO_03174 (xanA)
   00500 Starch and sucrose metabolism
    PXO_03174 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    PXO_03174 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    PXO_03174 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PXO_03174 (xanA)
Enzymes [BR:xop01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PXO_03174 (xanA)
    5.4.2.8  phosphomannomutase
     PXO_03174 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4621806..4623152
Genome map
AA seq 448 aa AA seqDB search
MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAG
LRASGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDT
GLFAIRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAG
LIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDHGADFGIAWDGDF
DRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA
RMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTDGISADFGEWRFNLRSSNTEP
LLRLNVETRGDAALLETRTQEISNLLRG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacccgccttcaaggcctacgatattcgcggccgcgtgccggatgaactcaac
gaggacttggcccgccgtatcggcgtggcgctggcggcgcagctggatcaggggccggtg
gtcctgggccacgatgtgcgcctggcgagcccggcgttgcaggaagcgctttccgccggc
ctgcgtgccagcggccgtgacgtgatcgatatcggtctgtgcggcaccgaggaagtctat
ttccagaccgattacctcaaggccgccggcggcgtgatggtcaccgccagccacaacccg
atggactacaacggcatgaagctggtgcgcgagcaagcgcggccgatcagctcggacacc
ggcctgttcgccatccgcgacacggtcgcggctgataccgccgcacccggcgagcccacc
gccagtgagcagagccgcaccgacaagaccgcgtacctggagcacctgctcagctacgtg
gaccgcagcaccctcaagccgctcaagctggtcgtcaacgccggcaacggcggcgccggg
ctgatcgtcgatctgctcgcgccgcatctgccgttcgaattcgtgcgcgttttccacgag
cccgatggcaacttccccaacggcatccccaatccgctgctgccggagaaccgcgatgcg
accgccaaggcagtcaaggaccatggcgccgatttcggcatcgcgtgggatggcgacttc
gatcgctgcttcttcttcgatcacacaggccgcttcatcgaaggctattacctggtcggc
ctgcttgcccaagccatcctggccaaacagccgggcggcaaggtcgtgcacgacccgcgc
ctgacctggaacacggtcgagcaggtcgaagaggccggcggcattccggtgctgtgcaag
agcggccacgccttcatcaaggaaaaaatgcgcagcgaaaatgccgtctatggcggcgaa
atgagcgcgcaccattatttccgtgagttcgcctatgccgactccggcatgattccgtgg
ctgctgatcgcagagctggtgtcgcagtcgggccgttcactggccgatctggtcgaagca
cgcatgcagaaattcccctgcagcggcgagatcaacttcaaggtcgccgatgccaaggca
tcggttgcgcgcgtgatggagcattacgcgtcgctgtctccggagctcgactacaccgac
ggcattagcgccgattttggcgaatggcgttttaatttgcgcagctccaacaccgagccg
ctgctgcgcctgaacgtggaaacgcgcggcgatgccgcactgctggaaacgcgtacgcag
gaaatttccaacctgctgcgcggctga

DBGET integrated database retrieval system