KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03245Help
Entry
PXO_03245         CDS       T00763                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xop00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:xop00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xop02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5145681..5147252)
Genome map
AA seq 523 aa AA seqDB search
MTASDPARRRILQGLGAGVLLPATAGWSARSLAAPSVRPIITDGVQSGDVLDGRAMLWSR
ADRPARLRVEWDTRPSLRQARRVDGTTASAAHDFTARADLSGLPRNQDIFNRVRFEDADS
GVLSAPVHGHLRSAPQARGDVRFVWSGDTVGQGFGINPDIGGMRIYSAMRERNPDFFLHS
GDTIYADSPIPAALTVEDGKRWRNLTTAAKSKVAETLDEFRGNYRYNLLDEHVRRFNAEV
PQIWQWDDHETTNNWSPGKQLDARYHVRDIDVLAKRARQAFLEYAPMRGVRADGNGRIYR
KIAYGPLLDVFVLDMRSYRGANSDNLQPQPGPDAAFLGPEQLAWLQRELAGSRAQWKVIA
ADMPIGLQVPDGEDANGRPRWEAIANGDPGAPRGREQEIATLLRFISRARIRNTVWLTAD
VHYCAAHYYHPDRAAFQEFEPFWEFVGGPLNAGSFGPNALDATFGPSVMFQKAPPAPNTS
PLAGYQFFGEVEIDGRSGVLTVTLRDLDGVAQFRQPILPHAAG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctccgatcccgcccgccgccgcatcctgcaaggcttgggtgccggtgtgttg
ttgccggctaccgccggctggtcagcgcgcagcctggccgcgccgtcggtgcggccgatc
atcaccgacggggtgcaaagcggcgatgtgctggacggccgcgcgatgctgtggagccgt
gccgatcgcccggcgcggttgcgggtggaatgggacacccgcccaagcctgcgtcaggcg
cgacgcgtggacggcacgacagcgtcggcagcgcacgacttcaccgcacgcgcggacctc
agcggcctgccgcgcaatcaggacatcttcaatcgcgtgcgcttcgaagatgcagacagc
ggtgtactgagcgcaccggtccacggtcatctgcgcagtgcaccgcaggcgcgtggcgat
gtgcgctttgtctggagcggcgacactgttggccagggcttcggcatcaatccggatatc
ggcggcatgcgcatctactcggcgatgcgcgagcgaaatccggatttcttcctgcacagc
ggcgacaccatctacgccgacagcccgattccggcggcgctgacggtcgaagacggcaag
cgctggcgcaatctcaccaccgcagccaagagcaaggtggccgaaacgctggacgaattt
cgcggcaactaccgttacaacctgctcgatgagcacgtgcgccgtttcaacgcagaagtg
ccgcaaatctggcaatgggacgaccacgaaactaccaacaactggtcgcccggcaagcaa
ttggatgcgcgctatcacgtgcgcgacatcgacgtgctggccaagcgcgcccgccaggcc
ttcctggaatacgcaccgatgcgcggcgtgcgtgccgatggcaacggacgcatctatcgc
aagatcgcgtacggcccgctgctggatgtattcgtgctggacatgcgcagctaccgcggc
gccaacagcgacaacctgcaaccgcagcctggccccgatgccgcgtttctcggcccggag
caattggcgtggctgcaacgcgaactggccggctcgcgcgcgcaatggaaagtgattgcc
gccgacatgccgatcggcctgcaggtccccgatggcgaagatgcgaacgggcgaccgcgc
tgggaagccatcgccaatggcgaccctggtgcgccgcgtggccgcgagcaggaaatcgcc
acgctgttgcgcttcatcagccgcgcacgcatccgcaatacggtgtggctgacggccgac
gtgcattactgcgcggcccattattaccaccccgatcgcgccgcgtttcaggagttcgaa
ccgttctgggaattcgtcggcggcccgctcaatgccggcagcttcgggccgaatgcactg
gatgcgacgttcggcccgagcgtgatgtttcaaaaagcgccacctgcgcccaacacctcg
ccgctggccggttaccagttcttcggcgaggtggagatcgatggccgcagcggcgtgctt
acggtgaccttgcgcgacctggatggcgtggcccagtttcgtcagccgattctgccgcac
gctgcggggtaa

DBGET integrated database retrieval system