KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03298Help
Entry
PXO_03298         CDS       T00763                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xop00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5102973..5104016)
Genome map
AA seq 347 aa AA seqDB search
MRTAALALTLLAATPLVQAKEPPGSKKETAGLKYVGVNLSGAEFNSRKKPGTLFKDYTYP
AASDFSYFAGKGMNTIRLPFLWERVQPALNGPLDQAQLGLIKKSLEAAKANKQYLILDLH
NYATYNGKRIGTSDVPASALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGA
INAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALQILKDPGNNMAFEAHQYLDKD
YSGTKPVCTSDSVGQEKLEGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMQKNS
DVWLGWTWWAAGSWWKPDYAFTVQPGKDGSDKPQMAILSKYARRAGK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaccgccgcgctcgcgttgaccttgctcgctgccaccccattggtccaggccaag
gagccgcctggctcgaagaaggaaaccgctggcctgaagtatgtcggcgtcaatctgtcc
ggcgccgagttcaactcgcgcaagaaacctggcaccttgttcaaggactacacctatcct
gccgcctcggacttcagctatttcgccggcaaaggcatgaatacgatccgcctaccgttc
ctgtgggagcgcgtgcagcccgcgctcaatggcccactggaccaggcccaattgggcttg
atcaagaaatctctggaagcagccaaggccaacaagcagtacctgatcctggacctgcac
aactacgccacgtacaacggcaagcgcatcggcaccagcgatgtgccggccagcgcattg
gccgatctgtggcgccggctggcgctggagttcaaggacgacaaggcggtgatcttcggg
ctgatgaacgagcccaacggcatttccgcacccgactgggccaatgccgcgcagggggcg
atcaacgcgatccgcaagaccggcgcgaagaatctgatcctggtgccaggcacggcgtat
accggcgcacacagctggcgcagcaccagctacggcgtctccaatgcaaaggcgctgcag
atcctcaaggacccgggcaacaacatggccttcgaagcgcatcaatacctggataaggac
tacagcggcaccaagccggtgtgcaccagcgactcggtaggccaggaaaagctggagggc
ttcacctcgtggttgcgcgaaaacaagcagaagggcttcctgggcgaattcgccacggcc
aataatcccgtctgcgacaaggcgctggaaggcatgctcacctatatgcaaaagaacagc
gacgtgtggctgggctggacctggtgggcggcgggttcctggtggaagccggactacgcc
ttcaccgtgcaaccgggcaaggacggcagcgacaagccgcagatggcgatcctgagcaag
tacgcacgccgtgccggcaagtag

DBGET integrated database retrieval system